Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C363

Protein Details
Accession A0A1Y2C363    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-58RHASCIRCSSRRRRPSRRSSSCRRRGKSPBasic
NLS Segment(s)
PositionSequence
40-56RRRRPSRRSSSCRRRGK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000206  Ribosomal_L7/12  
IPR014719  Ribosomal_L7/12_C/ClpS-like  
IPR013823  Ribosomal_L7/L12_C  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00542  Ribosomal_L12  
CDD cd00387  Ribosomal_L7_L12  
Amino Acid Sequences MSLGSWKLAGYDSVDIYSKDTDPPQHPRNRHASCIRCSSRRRRPSRRSSSCRRRGKSPEQTEFKVKLEKFDAAAKAKIIREVKNIIPGANLVEAKKFVESVPKVLKEGVPKEEAEKMKKMLEELGATVILE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.17
4 0.18
5 0.16
6 0.16
7 0.18
8 0.23
9 0.27
10 0.36
11 0.43
12 0.49
13 0.52
14 0.56
15 0.64
16 0.62
17 0.64
18 0.65
19 0.63
20 0.6
21 0.67
22 0.65
23 0.62
24 0.66
25 0.69
26 0.7
27 0.73
28 0.79
29 0.79
30 0.85
31 0.88
32 0.92
33 0.92
34 0.9
35 0.91
36 0.92
37 0.91
38 0.91
39 0.83
40 0.8
41 0.78
42 0.8
43 0.79
44 0.77
45 0.76
46 0.71
47 0.7
48 0.67
49 0.6
50 0.51
51 0.47
52 0.37
53 0.31
54 0.28
55 0.26
56 0.22
57 0.23
58 0.25
59 0.21
60 0.22
61 0.2
62 0.21
63 0.2
64 0.25
65 0.24
66 0.22
67 0.24
68 0.27
69 0.27
70 0.31
71 0.31
72 0.26
73 0.23
74 0.21
75 0.19
76 0.18
77 0.18
78 0.11
79 0.11
80 0.12
81 0.12
82 0.12
83 0.11
84 0.09
85 0.17
86 0.18
87 0.24
88 0.31
89 0.32
90 0.32
91 0.33
92 0.36
93 0.34
94 0.37
95 0.35
96 0.3
97 0.29
98 0.31
99 0.38
100 0.41
101 0.38
102 0.38
103 0.36
104 0.38
105 0.38
106 0.36
107 0.32
108 0.3
109 0.27
110 0.24
111 0.23