Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2B1J4

Protein Details
Accession A0A1Y2B1J4   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-66VTKGKGFTKEKNKKKRGSYRGGQIDQHydrophilic
NLS Segment(s)
PositionSequence
45-57KGFTKEKNKKKRG
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences FQRVKAENVVFVDERLKDNRFESKGGAISSYGMKAHQDLIVTKGKGFTKEKNKKKRGSYRGGQIDQESYSIKFNYDDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.21
5 0.24
6 0.31
7 0.3
8 0.3
9 0.29
10 0.29
11 0.3
12 0.28
13 0.26
14 0.18
15 0.16
16 0.16
17 0.15
18 0.11
19 0.08
20 0.08
21 0.08
22 0.09
23 0.09
24 0.09
25 0.08
26 0.12
27 0.16
28 0.16
29 0.16
30 0.19
31 0.18
32 0.23
33 0.26
34 0.3
35 0.37
36 0.47
37 0.57
38 0.64
39 0.72
40 0.76
41 0.83
42 0.86
43 0.84
44 0.83
45 0.81
46 0.8
47 0.81
48 0.76
49 0.68
50 0.59
51 0.52
52 0.42
53 0.37
54 0.28
55 0.19
56 0.19
57 0.18
58 0.17
59 0.16
60 0.15