Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CGN6

Protein Details
Accession A0A1Y2CGN6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-108VLRLRGGAKKRKKKTYTTPKKIKHKRKKVKLTILKFYKVBasic
NLS Segment(s)
PositionSequence
73-99LRGGAKKRKKKTYTTPKKIKHKRKKVK
Subcellular Location(s) cyto_nucl 15, nucl 14, cyto 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038582  S27a-like_sf  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019954  Ubiquitin_CS  
IPR019956  Ubiquitin_dom  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS00299  UBIQUITIN_1  
PS50053  UBIQUITIN_2  
CDD cd01803  Ubl_ubiquitin  
Amino Acid Sequences MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKTYTTPKKIKHKRKKVKLTILKFYKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.15
4 0.15
5 0.15
6 0.15
7 0.11
8 0.11
9 0.1
10 0.12
11 0.12
12 0.1
13 0.13
14 0.16
15 0.19
16 0.22
17 0.24
18 0.27
19 0.27
20 0.34
21 0.35
22 0.33
23 0.33
24 0.33
25 0.33
26 0.32
27 0.31
28 0.24
29 0.22
30 0.22
31 0.21
32 0.19
33 0.19
34 0.15
35 0.18
36 0.18
37 0.16
38 0.14
39 0.14
40 0.13
41 0.11
42 0.11
43 0.09
44 0.15
45 0.16
46 0.17
47 0.19
48 0.18
49 0.17
50 0.18
51 0.2
52 0.16
53 0.15
54 0.13
55 0.15
56 0.17
57 0.17
58 0.18
59 0.17
60 0.16
61 0.18
62 0.25
63 0.32
64 0.4
65 0.5
66 0.58
67 0.68
68 0.73
69 0.78
70 0.83
71 0.84
72 0.85
73 0.86
74 0.88
75 0.87
76 0.92
77 0.94
78 0.94
79 0.94
80 0.94
81 0.94
82 0.94
83 0.96
84 0.96
85 0.96
86 0.95
87 0.93
88 0.92