Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NXC5

Protein Details
Accession G9NXC5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-33PLPPNPYDLKKEKKKNEPFSRIDKNIHydrophilic
59-82VTKGKGFTKEKNKKKRGNFRAGVIHydrophilic
NLS Segment(s)
PositionSequence
63-75KGFTKEKNKKKRG
Subcellular Location(s) nucl 17.5, cyto_nucl 14.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MDSVPNPPLPPNPYDLKKEKKKNEPFSRIDKNIKVDPKFASNEYVSISYSQRAHEDLIVTKGKGFTKEKNKKKRGNFRAGVIDITEKKAVYFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.54
4 0.61
5 0.69
6 0.73
7 0.77
8 0.83
9 0.87
10 0.89
11 0.88
12 0.83
13 0.82
14 0.82
15 0.78
16 0.74
17 0.66
18 0.6
19 0.58
20 0.59
21 0.51
22 0.45
23 0.4
24 0.38
25 0.36
26 0.32
27 0.29
28 0.22
29 0.21
30 0.19
31 0.18
32 0.14
33 0.13
34 0.13
35 0.12
36 0.12
37 0.12
38 0.12
39 0.12
40 0.12
41 0.12
42 0.13
43 0.12
44 0.15
45 0.16
46 0.15
47 0.15
48 0.18
49 0.18
50 0.22
51 0.24
52 0.29
53 0.39
54 0.49
55 0.59
56 0.67
57 0.76
58 0.79
59 0.87
60 0.9
61 0.88
62 0.89
63 0.83
64 0.78
65 0.77
66 0.7
67 0.6
68 0.5
69 0.46
70 0.37
71 0.36
72 0.32
73 0.23
74 0.21