Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2D2Z9

Protein Details
Accession A0A1Y2D2Z9   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-29ATCQIVKVEKRGRRKGRKLVDIVSHydrophilic
NLS Segment(s)
PositionSequence
15-23KRGRRKGRK
Subcellular Location(s) nucl 13, cyto_nucl 12, cyto 9, mito 3
Family & Domain DBs
Amino Acid Sequences MTEHTATCQIVKVEKRGRRKGRKLVDIVSEVLPDYNNLGDEETMIVLERVYQFLQRNGVEMMKADVHDEFTVAGGLVYELQIHLFRKLRKVFNGRVLKDPRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.56
3 0.64
4 0.73
5 0.77
6 0.84
7 0.85
8 0.86
9 0.88
10 0.83
11 0.77
12 0.72
13 0.63
14 0.55
15 0.45
16 0.35
17 0.26
18 0.21
19 0.16
20 0.1
21 0.09
22 0.07
23 0.06
24 0.06
25 0.07
26 0.06
27 0.06
28 0.07
29 0.06
30 0.05
31 0.05
32 0.04
33 0.03
34 0.05
35 0.05
36 0.06
37 0.06
38 0.09
39 0.1
40 0.11
41 0.15
42 0.14
43 0.15
44 0.15
45 0.15
46 0.12
47 0.12
48 0.12
49 0.09
50 0.09
51 0.08
52 0.08
53 0.09
54 0.09
55 0.09
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.08
69 0.09
70 0.14
71 0.19
72 0.22
73 0.31
74 0.39
75 0.44
76 0.51
77 0.59
78 0.61
79 0.66
80 0.74
81 0.68
82 0.7