Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CW11

Protein Details
Accession A0A1Y2CW11    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-24WLTVWKRESRKWMKRVNLSLKEVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Pfam View protein in Pfam  
PF17123  zf-RING_11  
Amino Acid Sequences MWLTVWKRESRKWMKRVNLSLKEVILSDQDISFRKTSGTDVCAICRDVYSSGDVVGQLGCTHEFHQECVHRLDYQTIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.85
4 0.85
5 0.81
6 0.76
7 0.69
8 0.6
9 0.51
10 0.42
11 0.32
12 0.22
13 0.15
14 0.11
15 0.09
16 0.1
17 0.11
18 0.13
19 0.13
20 0.12
21 0.11
22 0.11
23 0.13
24 0.13
25 0.14
26 0.15
27 0.15
28 0.16
29 0.17
30 0.17
31 0.15
32 0.13
33 0.12
34 0.1
35 0.1
36 0.11
37 0.09
38 0.09
39 0.09
40 0.09
41 0.08
42 0.07
43 0.07
44 0.05
45 0.06
46 0.07
47 0.08
48 0.09
49 0.15
50 0.15
51 0.17
52 0.25
53 0.28
54 0.3
55 0.33
56 0.34
57 0.3
58 0.31