Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CBY0

Protein Details
Accession A0A1Y2CBY0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-86PRTSRRCPIRHQRPCPYHRKLBasic
102-132GLRNQTNKRHNPNPNLRPKHHPRLPQRRALWHydrophilic
NLS Segment(s)
PositionSequence
96-129RLRNRMGLRNQTNKRHNPNPNLRPKHHPRLPQRR
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MRFAHLLFFLWTERRVRYSNVVQKARTICTGAVKASASASASAGSSNTTASNSNSGDPPQLALSHPRTSRRCPIRHQRPCPYHRKLLRYILQRKQRLRNRMGLRNQTNKRHNPNPNLRPKHHPRLPQRRALWNHWRRSVTDPWIRRSPLLRVYPETQDSGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.3
4 0.36
5 0.43
6 0.5
7 0.56
8 0.59
9 0.55
10 0.59
11 0.59
12 0.54
13 0.46
14 0.39
15 0.3
16 0.3
17 0.32
18 0.26
19 0.25
20 0.22
21 0.2
22 0.18
23 0.18
24 0.12
25 0.11
26 0.1
27 0.08
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.09
37 0.1
38 0.13
39 0.13
40 0.14
41 0.15
42 0.15
43 0.15
44 0.14
45 0.14
46 0.11
47 0.11
48 0.1
49 0.14
50 0.18
51 0.22
52 0.25
53 0.31
54 0.34
55 0.38
56 0.47
57 0.51
58 0.51
59 0.54
60 0.64
61 0.67
62 0.74
63 0.77
64 0.78
65 0.78
66 0.81
67 0.81
68 0.75
69 0.73
70 0.68
71 0.66
72 0.61
73 0.6
74 0.6
75 0.6
76 0.63
77 0.62
78 0.66
79 0.67
80 0.69
81 0.7
82 0.71
83 0.71
84 0.66
85 0.68
86 0.66
87 0.68
88 0.7
89 0.7
90 0.7
91 0.71
92 0.74
93 0.73
94 0.74
95 0.73
96 0.74
97 0.73
98 0.74
99 0.74
100 0.78
101 0.79
102 0.81
103 0.81
104 0.77
105 0.77
106 0.78
107 0.79
108 0.75
109 0.74
110 0.74
111 0.78
112 0.81
113 0.8
114 0.77
115 0.76
116 0.76
117 0.75
118 0.76
119 0.73
120 0.74
121 0.72
122 0.68
123 0.62
124 0.61
125 0.6
126 0.58
127 0.59
128 0.56
129 0.55
130 0.61
131 0.6
132 0.57
133 0.53
134 0.51
135 0.51
136 0.53
137 0.5
138 0.49
139 0.51
140 0.54
141 0.53
142 0.5
143 0.43