Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CA98

Protein Details
Accession A0A1Y2CA98   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-50HSYLRKPQASRQPNPKQKQKTITNQSKPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNSYISFDKKRIPFRSIPHLNLHSYLRKPQASRQPNPKQKQKTITNQSKPSHSQCPHQDIHLQQRGDTHPTQTAAQSHPLLQQQPSRHQEPGASAIDWVFQARGSLQGRLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.67
3 0.66
4 0.63
5 0.61
6 0.59
7 0.54
8 0.5
9 0.49
10 0.44
11 0.39
12 0.41
13 0.39
14 0.4
15 0.4
16 0.45
17 0.51
18 0.54
19 0.59
20 0.64
21 0.68
22 0.74
23 0.8
24 0.82
25 0.8
26 0.78
27 0.8
28 0.77
29 0.77
30 0.78
31 0.8
32 0.78
33 0.78
34 0.73
35 0.69
36 0.64
37 0.58
38 0.57
39 0.48
40 0.47
41 0.43
42 0.47
43 0.43
44 0.4
45 0.39
46 0.33
47 0.4
48 0.39
49 0.34
50 0.28
51 0.32
52 0.32
53 0.33
54 0.31
55 0.24
56 0.2
57 0.21
58 0.22
59 0.2
60 0.21
61 0.18
62 0.21
63 0.2
64 0.19
65 0.21
66 0.23
67 0.23
68 0.23
69 0.27
70 0.28
71 0.36
72 0.41
73 0.41
74 0.4
75 0.38
76 0.37
77 0.36
78 0.37
79 0.3
80 0.25
81 0.21
82 0.2
83 0.2
84 0.18
85 0.16
86 0.1
87 0.07
88 0.08
89 0.08
90 0.16
91 0.17