Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2ALN8

Protein Details
Accession A0A1Y2ALN8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-106FIKYKEGRLSKPRRRERSEECREYNIHydrophilic
NLS Segment(s)
PositionSequence
54-68AKVKGVDKRRERGVR
87-95GRLSKPRRR
Subcellular Location(s) cyto_nucl 14.5, nucl 13.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
Amino Acid Sequences MSTIQNPNTPVDVVSEALNAVYDVYGDAVYPWDSVFVNGKYLDVLRGVLPGFKAKVKGVDKRRERGVRERAEEALLNLGAFIKYKEGRLSKPRRRERSEECREYNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.11
4 0.11
5 0.1
6 0.07
7 0.06
8 0.05
9 0.04
10 0.04
11 0.05
12 0.04
13 0.04
14 0.04
15 0.05
16 0.06
17 0.06
18 0.06
19 0.07
20 0.07
21 0.08
22 0.12
23 0.11
24 0.12
25 0.12
26 0.12
27 0.12
28 0.12
29 0.11
30 0.08
31 0.08
32 0.06
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.09
39 0.09
40 0.11
41 0.1
42 0.18
43 0.21
44 0.29
45 0.37
46 0.45
47 0.5
48 0.54
49 0.63
50 0.61
51 0.62
52 0.64
53 0.64
54 0.62
55 0.61
56 0.58
57 0.5
58 0.46
59 0.41
60 0.32
61 0.25
62 0.17
63 0.13
64 0.1
65 0.09
66 0.08
67 0.08
68 0.08
69 0.1
70 0.11
71 0.13
72 0.2
73 0.24
74 0.31
75 0.42
76 0.53
77 0.57
78 0.67
79 0.76
80 0.8
81 0.84
82 0.86
83 0.85
84 0.86
85 0.87
86 0.86