Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2C2R4

Protein Details
Accession A0A1Y2C2R4    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-74SCPVCSRAFKRPQDLKKHEKLHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences EALYDHLTNDHVGRGKGLELICRWGPGPCNQSYSKRDHLTSHLRIHVPLKPHSCPVCSRAFKRPQDLKKHEKLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.19
4 0.18
5 0.18
6 0.16
7 0.21
8 0.2
9 0.2
10 0.2
11 0.17
12 0.19
13 0.22
14 0.25
15 0.22
16 0.26
17 0.28
18 0.34
19 0.37
20 0.4
21 0.41
22 0.39
23 0.39
24 0.36
25 0.4
26 0.42
27 0.44
28 0.42
29 0.39
30 0.37
31 0.37
32 0.37
33 0.34
34 0.3
35 0.31
36 0.31
37 0.29
38 0.35
39 0.36
40 0.36
41 0.36
42 0.36
43 0.4
44 0.42
45 0.44
46 0.48
47 0.56
48 0.6
49 0.67
50 0.73
51 0.72
52 0.77
53 0.82
54 0.81