Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2C8Z6

Protein Details
Accession A0A1Y2C8Z6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-33VWAVPKKRTTHGKKRLRMNSKWHydrophilic
NLS Segment(s)
PositionSequence
17-28KKRTTHGKKRLR
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAPLSWFPSIVWAVPKKRTTHGKKRLRMNSKWLRPMKNIIQCPLCGSPSLLHHACKTCMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.36
3 0.4
4 0.39
5 0.45
6 0.54
7 0.58
8 0.63
9 0.69
10 0.72
11 0.74
12 0.82
13 0.85
14 0.82
15 0.76
16 0.75
17 0.75
18 0.72
19 0.74
20 0.7
21 0.64
22 0.59
23 0.62
24 0.6
25 0.58
26 0.54
27 0.49
28 0.46
29 0.42
30 0.44
31 0.39
32 0.31
33 0.23
34 0.22
35 0.2
36 0.2
37 0.28
38 0.26
39 0.26
40 0.3
41 0.33