Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CPZ6

Protein Details
Accession A0A1Y2CPZ6    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MEAPIDRKRSRQQVPRLIKHVNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, nucl 3.5, cyto_nucl 3.5, mito 3, E.R. 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000157  TIR_dom  
IPR035897  Toll_tir_struct_dom_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF13676  TIR_2  
Amino Acid Sequences MEAPIDRKRSRQQVPRLIKHVNTAEVNEFDVMLSYSWTTKEQVLGLCDALTEILPGIKIWVDRDEMNGNVNLAMARGILKSSVIIVCLSVAYLVGVAPISHSVELKTTSTSELVEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.81
4 0.76
5 0.68
6 0.65
7 0.58
8 0.52
9 0.43
10 0.37
11 0.34
12 0.3
13 0.29
14 0.22
15 0.18
16 0.13
17 0.12
18 0.1
19 0.07
20 0.06
21 0.06
22 0.06
23 0.07
24 0.09
25 0.1
26 0.1
27 0.11
28 0.12
29 0.13
30 0.14
31 0.14
32 0.13
33 0.11
34 0.1
35 0.09
36 0.07
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.04
46 0.05
47 0.07
48 0.09
49 0.09
50 0.11
51 0.13
52 0.13
53 0.14
54 0.13
55 0.12
56 0.1
57 0.1
58 0.07
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.06
76 0.05
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.04
83 0.03
84 0.04
85 0.06
86 0.08
87 0.08
88 0.09
89 0.09
90 0.12
91 0.14
92 0.15
93 0.16
94 0.15
95 0.17
96 0.17