Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CIZ4

Protein Details
Accession A0A1Y2CIZ4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
158-179DTIDILHPKKDKKKRPKIEVLKBasic
NLS Segment(s)
PositionSequence
165-176PKKDKKKRPKIE
Subcellular Location(s) mito 16, mito_nucl 12.666, cyto_mito 9.666, nucl 8, cyto_nucl 5.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR027921  NOPCHAP1  
Gene Ontology GO:0000492  P:box C/D snoRNP assembly  
Pfam View protein in Pfam  
PF15370  NOPCHAP1  
Amino Acid Sequences MKNKKKSTPSSASSASSASASNIGPVLSSVKKTKPANETSVLQSLLSISAVPTKGATFRVDTKNDLLSKVASFLPQLKQANESLQQTIEAGQSVDIEHVDETEQHIEMDLGLGVFDYAPEDIHKIPKKDVILLKKDDDDSESDKEELVTLKLKPDSDDTIDILHPKKDKKKRPKIEVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.35
3 0.27
4 0.22
5 0.16
6 0.14
7 0.12
8 0.11
9 0.11
10 0.1
11 0.09
12 0.09
13 0.13
14 0.12
15 0.15
16 0.19
17 0.22
18 0.3
19 0.33
20 0.4
21 0.43
22 0.47
23 0.5
24 0.5
25 0.5
26 0.46
27 0.47
28 0.4
29 0.32
30 0.26
31 0.2
32 0.16
33 0.13
34 0.09
35 0.05
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.11
42 0.12
43 0.14
44 0.13
45 0.19
46 0.25
47 0.27
48 0.28
49 0.29
50 0.33
51 0.32
52 0.3
53 0.24
54 0.19
55 0.17
56 0.17
57 0.15
58 0.1
59 0.1
60 0.13
61 0.14
62 0.19
63 0.2
64 0.19
65 0.2
66 0.21
67 0.23
68 0.23
69 0.22
70 0.16
71 0.15
72 0.14
73 0.13
74 0.13
75 0.1
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.06
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.04
106 0.04
107 0.06
108 0.08
109 0.16
110 0.21
111 0.22
112 0.24
113 0.29
114 0.29
115 0.34
116 0.4
117 0.4
118 0.42
119 0.44
120 0.45
121 0.44
122 0.43
123 0.37
124 0.32
125 0.28
126 0.25
127 0.24
128 0.24
129 0.21
130 0.2
131 0.2
132 0.19
133 0.16
134 0.14
135 0.14
136 0.13
137 0.18
138 0.2
139 0.21
140 0.22
141 0.25
142 0.27
143 0.29
144 0.3
145 0.26
146 0.26
147 0.27
148 0.29
149 0.27
150 0.27
151 0.28
152 0.34
153 0.43
154 0.51
155 0.61
156 0.69
157 0.78
158 0.84
159 0.9