Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CTX2

Protein Details
Accession A0A1Y2CTX2   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
110-132GLRLKLSSLKRKKTSKKEVALNEHydrophilic
NLS Segment(s)
PositionSequence
113-126LKLSSLKRKKTSKK
Subcellular Location(s) nucl 17.5, mito_nucl 13.5, mito 8.5
Family & Domain DBs
Amino Acid Sequences MRTPTSKGNNPALPKKAADRAFKSVPRNSLPNSSATSLDAPIQGVADETSELKTTPLKRQKLGRHEPALLRKVTYPTRENVTSNIKLKKDPFHRHATAAVRIKKNESLNGLRLKLSSLKRKKTSKKEVALNEAVVANFRKGPTPNPSIHTVTLFRVSEALLNTLKRQLGMMFGMFTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.53
4 0.53
5 0.54
6 0.52
7 0.54
8 0.59
9 0.62
10 0.63
11 0.6
12 0.59
13 0.55
14 0.54
15 0.5
16 0.5
17 0.45
18 0.42
19 0.4
20 0.35
21 0.31
22 0.28
23 0.26
24 0.19
25 0.19
26 0.16
27 0.13
28 0.11
29 0.11
30 0.09
31 0.07
32 0.07
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.08
40 0.12
41 0.15
42 0.25
43 0.33
44 0.37
45 0.41
46 0.49
47 0.57
48 0.63
49 0.69
50 0.67
51 0.63
52 0.63
53 0.64
54 0.63
55 0.58
56 0.48
57 0.4
58 0.33
59 0.33
60 0.33
61 0.32
62 0.27
63 0.25
64 0.29
65 0.3
66 0.29
67 0.29
68 0.31
69 0.31
70 0.34
71 0.37
72 0.33
73 0.33
74 0.35
75 0.39
76 0.41
77 0.45
78 0.45
79 0.48
80 0.49
81 0.48
82 0.51
83 0.47
84 0.44
85 0.44
86 0.46
87 0.4
88 0.39
89 0.4
90 0.4
91 0.39
92 0.34
93 0.32
94 0.29
95 0.32
96 0.36
97 0.35
98 0.3
99 0.28
100 0.27
101 0.28
102 0.3
103 0.36
104 0.4
105 0.48
106 0.56
107 0.66
108 0.74
109 0.78
110 0.83
111 0.83
112 0.82
113 0.82
114 0.79
115 0.77
116 0.7
117 0.59
118 0.49
119 0.4
120 0.32
121 0.25
122 0.2
123 0.13
124 0.13
125 0.13
126 0.15
127 0.16
128 0.21
129 0.27
130 0.31
131 0.34
132 0.36
133 0.41
134 0.41
135 0.41
136 0.4
137 0.34
138 0.31
139 0.34
140 0.3
141 0.25
142 0.22
143 0.21
144 0.2
145 0.19
146 0.2
147 0.17
148 0.18
149 0.2
150 0.24
151 0.24
152 0.21
153 0.21
154 0.18
155 0.18
156 0.19
157 0.19