Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BV94

Protein Details
Accession A0A1Y2BV94    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26SRSRPFPCPTCPKRFLRKQDLARHEAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PF13894  zf-C2H2_4  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences SRSRPFPCPTCPKRFLRKQDLARHEATHTRDKKFVCSGCGTGFARQDALGRHTKSCMFNKIPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.8
4 0.82
5 0.81
6 0.84
7 0.83
8 0.77
9 0.69
10 0.61
11 0.53
12 0.48
13 0.43
14 0.42
15 0.39
16 0.37
17 0.38
18 0.37
19 0.38
20 0.39
21 0.36
22 0.3
23 0.29
24 0.28
25 0.25
26 0.3
27 0.28
28 0.25
29 0.25
30 0.22
31 0.19
32 0.18
33 0.19
34 0.16
35 0.2
36 0.25
37 0.25
38 0.26
39 0.28
40 0.33
41 0.38
42 0.42
43 0.47