Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CPV8

Protein Details
Accession A0A1Y2CPV8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-45CLWLQKRTLPRPKRLHKRMLNVRLEYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MLQEEFTCFGLSLSPPFHHCLWLQKRTLPRPKRLHKRMLNVRLEYCKLDLSFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.19
4 0.19
5 0.2
6 0.2
7 0.27
8 0.32
9 0.37
10 0.37
11 0.37
12 0.44
13 0.51
14 0.6
15 0.57
16 0.59
17 0.64
18 0.73
19 0.8
20 0.81
21 0.83
22 0.8
23 0.85
24 0.85
25 0.85
26 0.83
27 0.76
28 0.73
29 0.68
30 0.63
31 0.54
32 0.45
33 0.39