FuNGI

A0A1Y2ET78

Protein Details

Accession

A0A1Y2ET78

Localization Confidence

Low

Confidence Score

6.1

NoLS Segment(s)

Position	Sequence	Protein Nature
1-21	MKRRPSPPSSARPRQPSLPKN	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 12, plas 9, nucl 3, cyto 1, E.R. 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR027417 P-loop_NTPase IPR000836 PRibTrfase_dom IPR006083 PRK/URK IPR029057 PRTase-like IPR000764 Uridine_kinase-like
Gene Ontology	GO:0005524 F:ATP binding GO:0004849 F:uridine kinase activity GO:0016310 P:phosphorylation GO:0044206 P:UMP salvage
Pfam	View protein in Pfam PF00485 PRK PF14681 UPRTase
CDD	cd06223 PRTases_typeI cd02023 UMPK

Amino Acid Sequences

MKRRPSPPSSARPRQPSLPKNTILTEAGRSPWYSKDGQTNGAYCIGIAGGSASGKTRVATEILKSLGVPWVLVISQDNFYNSLSPDQSAAAFRNEHDFDSPQSFDYDKLRQVIVDLKACKSVQIPNYSFVLHQRTEETTYLYGAAVIIIEGLFVLHDKAIRDVLDLKVFVQCDSDLMLARRLRRDLVERGRDAAGVLDQYLRFVKPSFDDHIQPTSRYADILVPGQANEKSIDLITGHIRRQLDERKLELRGELFSDTQGEENGGRNGEVRLPETVTLLKEGSQLKGIHTILRSHSTLREEFRFFADRLSTLVIETALSLLPSRPKPITTRTGISHIGQELDILPNHLCGVSILRSGASLEKGLRRVLRDCPIGSVLIQSDRDSGEPLLYEASLPGCITASAESASKSFVLLLDAQIGTGAAALMAVRVLLDHGVPEENVLLCTILVSKVGGVWALRRAFPRVRIVSSAADDGLEERTEETRAGPKKVFAITPGFGCSFGDRYFGAP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.8
2	0.81
3	0.8
4	0.79
5	0.77
6	0.72
7	0.67
8	0.64
9	0.58
10	0.5
11	0.43
12	0.38
13	0.32
14	0.3
15	0.28
16	0.27
17	0.25
18	0.27
19	0.28
20	0.27
21	0.29
22	0.36
23	0.37
24	0.42
25	0.44
26	0.42
27	0.4
28	0.39
29	0.35
30	0.25
31	0.22
32	0.15
33	0.11
34	0.08
35	0.07
36	0.05
37	0.05
38	0.06
39	0.07
40	0.08
41	0.09
42	0.1
43	0.11
44	0.11
45	0.14
46	0.16
47	0.18
48	0.21
49	0.22
50	0.22
51	0.2
52	0.19
53	0.2
54	0.18
55	0.15
56	0.11
57	0.11
58	0.1
59	0.11
60	0.12
61	0.1
62	0.12
63	0.13
64	0.14
65	0.14
66	0.14
67	0.16
68	0.15
69	0.17
70	0.17
71	0.16
72	0.16
73	0.16
74	0.17
75	0.17
76	0.18
77	0.17
78	0.16
79	0.16
80	0.23
81	0.23
82	0.23
83	0.23
84	0.23
85	0.23
86	0.27
87	0.27
88	0.2
89	0.21
90	0.21
91	0.2
92	0.23
93	0.25
94	0.23
95	0.25
96	0.24
97	0.22
98	0.23
99	0.28
100	0.28
101	0.3
102	0.29
103	0.28
104	0.32
105	0.32
106	0.31
107	0.26
108	0.29
109	0.28
110	0.35
111	0.36
112	0.34
113	0.35
114	0.35
115	0.33
116	0.31
117	0.31
118	0.22
119	0.21
120	0.22
121	0.23
122	0.26
123	0.26
124	0.24
125	0.19
126	0.19
127	0.18
128	0.16
129	0.13
130	0.09
131	0.08
132	0.05
133	0.04
134	0.04
135	0.03
136	0.03
137	0.02
138	0.02
139	0.02
140	0.03
141	0.03
142	0.04
143	0.05
144	0.06
145	0.08
146	0.09
147	0.09
148	0.11
149	0.13
150	0.14
151	0.15
152	0.15
153	0.14
154	0.16
155	0.16
156	0.14
157	0.13
158	0.11
159	0.09
160	0.1
161	0.11
162	0.1
163	0.11
164	0.16
165	0.17
166	0.2
167	0.23
168	0.23
169	0.23
170	0.24
171	0.29
172	0.33
173	0.4
174	0.44
175	0.42
176	0.44
177	0.43
178	0.4
179	0.34
180	0.25
181	0.16
182	0.09
183	0.09
184	0.08
185	0.07
186	0.08
187	0.09
188	0.09
189	0.09
190	0.09
191	0.1
192	0.1
193	0.14
194	0.18
195	0.19
196	0.22
197	0.24
198	0.29
199	0.29
200	0.27
201	0.25
202	0.23
203	0.2
204	0.18
205	0.16
206	0.11
207	0.12
208	0.12
209	0.12
210	0.1
211	0.1
212	0.12
213	0.11
214	0.1
215	0.1
216	0.09
217	0.08
218	0.08
219	0.08
220	0.06
221	0.08
222	0.11
223	0.14
224	0.14
225	0.17
226	0.17
227	0.17
228	0.23
229	0.29
230	0.3
231	0.3
232	0.33
233	0.33
234	0.34
235	0.34
236	0.29
237	0.22
238	0.17
239	0.15
240	0.13
241	0.11
242	0.09
243	0.1
244	0.09
245	0.08
246	0.08
247	0.07
248	0.07
249	0.08
250	0.09
251	0.08
252	0.08
253	0.08
254	0.09
255	0.1
256	0.1
257	0.1
258	0.1
259	0.1
260	0.11
261	0.11
262	0.12
263	0.1
264	0.1
265	0.1
266	0.09
267	0.13
268	0.14
269	0.13
270	0.16
271	0.16
272	0.16
273	0.21
274	0.21
275	0.19
276	0.2
277	0.21
278	0.19
279	0.22
280	0.22
281	0.18
282	0.21
283	0.21
284	0.23
285	0.24
286	0.27
287	0.25
288	0.25
289	0.27
290	0.27
291	0.24
292	0.23
293	0.21
294	0.17
295	0.16
296	0.17
297	0.13
298	0.1
299	0.1
300	0.08
301	0.07
302	0.07
303	0.06
304	0.05
305	0.04
306	0.05
307	0.06
308	0.11
309	0.12
310	0.15
311	0.15
312	0.17
313	0.21
314	0.27
315	0.33
316	0.32
317	0.35
318	0.34
319	0.38
320	0.38
321	0.35
322	0.32
323	0.25
324	0.22
325	0.18
326	0.16
327	0.12
328	0.12
329	0.11
330	0.1
331	0.09
332	0.08
333	0.09
334	0.08
335	0.07
336	0.06
337	0.09
338	0.09
339	0.1
340	0.1
341	0.09
342	0.1
343	0.1
344	0.12
345	0.1
346	0.1
347	0.12
348	0.16
349	0.18
350	0.21
351	0.23
352	0.24
353	0.26
354	0.31
355	0.35
356	0.36
357	0.34
358	0.34
359	0.33
360	0.3
361	0.27
362	0.23
363	0.17
364	0.16
365	0.17
366	0.14
367	0.14
368	0.15
369	0.15
370	0.15
371	0.14
372	0.11
373	0.11
374	0.1
375	0.1
376	0.09
377	0.09
378	0.07
379	0.07
380	0.07
381	0.07
382	0.06
383	0.06
384	0.06
385	0.07
386	0.07
387	0.07
388	0.08
389	0.09
390	0.09
391	0.09
392	0.1
393	0.09
394	0.09
395	0.08
396	0.08
397	0.09
398	0.09
399	0.1
400	0.12
401	0.12
402	0.12
403	0.11
404	0.11
405	0.08
406	0.07
407	0.07
408	0.03
409	0.03
410	0.03
411	0.03
412	0.03
413	0.03
414	0.02
415	0.03
416	0.03
417	0.04
418	0.04
419	0.04
420	0.06
421	0.07
422	0.07
423	0.08
424	0.09
425	0.09
426	0.1
427	0.1
428	0.08
429	0.07
430	0.08
431	0.08
432	0.07
433	0.07
434	0.07
435	0.07
436	0.07
437	0.08
438	0.08
439	0.08
440	0.1
441	0.16
442	0.18
443	0.21
444	0.23
445	0.29
446	0.33
447	0.39
448	0.46
449	0.45
450	0.46
451	0.47
452	0.48
453	0.46
454	0.44
455	0.4
456	0.3
457	0.25
458	0.21
459	0.18
460	0.17
461	0.13
462	0.11
463	0.1
464	0.12
465	0.13
466	0.13
467	0.15
468	0.21
469	0.26
470	0.31
471	0.32
472	0.33
473	0.37
474	0.41
475	0.4
476	0.35
477	0.36
478	0.33
479	0.33
480	0.34
481	0.3
482	0.26
483	0.26
484	0.25
485	0.22
486	0.2
487	0.21

A0A1Y2ET78

3D AlphaFold-predicted Structure Viewer