Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2G3R1

Protein Details
Accession A0A1Y2G3R1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-29KNESNIGKTKKPKNAPVKKHATKKGKSBasic
NLS Segment(s)
PositionSequence
10-28KTKKPKNAPVKKHATKKGK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MAKNESNIGKTKKPKNAPVKKHATKKGKSSTYNSYMTAKLAELKAKNPSQDQRERMKEVLALYKAEQKEKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.82
4 0.83
5 0.83
6 0.85
7 0.84
8 0.86
9 0.85
10 0.84
11 0.79
12 0.79
13 0.78
14 0.75
15 0.71
16 0.66
17 0.64
18 0.6
19 0.57
20 0.49
21 0.42
22 0.34
23 0.3
24 0.25
25 0.17
26 0.14
27 0.13
28 0.16
29 0.14
30 0.16
31 0.23
32 0.24
33 0.26
34 0.29
35 0.35
36 0.38
37 0.46
38 0.5
39 0.52
40 0.57
41 0.6
42 0.55
43 0.5
44 0.45
45 0.39
46 0.41
47 0.33
48 0.29
49 0.26
50 0.33
51 0.33
52 0.36