Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C3Y4

Protein Details
Accession A0A1Y2C3Y4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-130LAQAKEKTGRKLRKERKNRGKKFRGTQAAKKSAEBasic
NLS Segment(s)
PositionSequence
100-134AKEKTGRKLRKERKNRGKKFRGTQAAKKSAEGKKK
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDPTGAVTIRTRKFLTNRLLQRKQMVVDVLHPTRANVSKDELRDKLSAMYKAPKDQVIVFGFRTQFGGGKSTGFALIYDSKDALKFEPRYRLIRFGLAQAKEKTGRKLRKERKNRGKKFRGTQAAKKSAEGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.52
4 0.6
5 0.66
6 0.71
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.31
15 0.34
16 0.3
17 0.29
18 0.27
19 0.24
20 0.26
21 0.3
22 0.27
23 0.22
24 0.26
25 0.28
26 0.32
27 0.37
28 0.34
29 0.32
30 0.31
31 0.3
32 0.29
33 0.29
34 0.27
35 0.23
36 0.29
37 0.27
38 0.29
39 0.3
40 0.26
41 0.24
42 0.23
43 0.26
44 0.21
45 0.21
46 0.18
47 0.2
48 0.19
49 0.17
50 0.18
51 0.12
52 0.12
53 0.11
54 0.12
55 0.09
56 0.09
57 0.09
58 0.09
59 0.09
60 0.07
61 0.07
62 0.07
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.11
69 0.12
70 0.11
71 0.16
72 0.19
73 0.22
74 0.31
75 0.34
76 0.39
77 0.41
78 0.45
79 0.39
80 0.4
81 0.37
82 0.35
83 0.39
84 0.36
85 0.39
86 0.35
87 0.38
88 0.39
89 0.41
90 0.43
91 0.46
92 0.53
93 0.57
94 0.67
95 0.73
96 0.78
97 0.86
98 0.89
99 0.91
100 0.93
101 0.94
102 0.94
103 0.94
104 0.93
105 0.91
106 0.9
107 0.9
108 0.87
109 0.86
110 0.86
111 0.85
112 0.76
113 0.7
114 0.68