Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9PB50

Protein Details
Accession G9PB50    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-30QGIPKERKKLPTKFQSVKKMEHydrophilic
NLS Segment(s)
PositionSequence
17-17K
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MKLLAISHHQGIPKERKKLPTKFQSVKKMEYRHGRDGVPLRIKNGPHRVTKLAPGNRITIDLDNKSSAPDTTAGRHDNVHLPSISIQRRHPNPAAFQHGLISSSIGARDARLGFDSAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.61
4 0.68
5 0.75
6 0.77
7 0.76
8 0.79
9 0.79
10 0.83
11 0.84
12 0.79
13 0.78
14 0.75
15 0.7
16 0.67
17 0.69
18 0.67
19 0.64
20 0.62
21 0.55
22 0.53
23 0.53
24 0.53
25 0.51
26 0.45
27 0.4
28 0.4
29 0.42
30 0.43
31 0.48
32 0.44
33 0.4
34 0.43
35 0.44
36 0.41
37 0.46
38 0.47
39 0.42
40 0.41
41 0.38
42 0.36
43 0.32
44 0.32
45 0.27
46 0.2
47 0.19
48 0.16
49 0.15
50 0.14
51 0.14
52 0.13
53 0.13
54 0.1
55 0.09
56 0.1
57 0.1
58 0.12
59 0.16
60 0.17
61 0.17
62 0.18
63 0.19
64 0.22
65 0.22
66 0.22
67 0.18
68 0.18
69 0.2
70 0.27
71 0.29
72 0.26
73 0.29
74 0.36
75 0.4
76 0.46
77 0.48
78 0.46
79 0.48
80 0.52
81 0.56
82 0.48
83 0.45
84 0.4
85 0.35
86 0.31
87 0.25
88 0.19
89 0.11
90 0.11
91 0.1
92 0.1
93 0.09
94 0.09
95 0.14
96 0.14
97 0.15
98 0.16