Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2F5Z1

Protein Details
Accession A0A1Y2F5Z1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-25RVTLRTRKSYNTKSNGKRIVKTHydrophilic
NLS Segment(s)
PositionSequence
104-114VIKSQGKPSKK
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MVQRVTLRTRKSYNTKSNGKRIVKTPGGKLRYLVVKKQATSPKCGDCHIALPGVPALRPRQYAQISKRQKTVQRAYGGSRCANCVRDRIVRSFLVEEAKIVKKVIKSQGKPSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.79
4 0.83
5 0.84
6 0.8
7 0.74
8 0.69
9 0.69
10 0.66
11 0.62
12 0.61
13 0.6
14 0.58
15 0.54
16 0.5
17 0.45
18 0.46
19 0.45
20 0.4
21 0.4
22 0.4
23 0.4
24 0.47
25 0.51
26 0.43
27 0.46
28 0.46
29 0.43
30 0.41
31 0.41
32 0.35
33 0.28
34 0.29
35 0.24
36 0.2
37 0.14
38 0.13
39 0.13
40 0.1
41 0.1
42 0.09
43 0.1
44 0.11
45 0.13
46 0.14
47 0.2
48 0.23
49 0.3
50 0.33
51 0.42
52 0.49
53 0.5
54 0.54
55 0.52
56 0.55
57 0.57
58 0.6
59 0.57
60 0.53
61 0.53
62 0.53
63 0.52
64 0.49
65 0.43
66 0.36
67 0.33
68 0.3
69 0.31
70 0.28
71 0.27
72 0.29
73 0.34
74 0.37
75 0.37
76 0.39
77 0.36
78 0.38
79 0.36
80 0.32
81 0.29
82 0.25
83 0.22
84 0.23
85 0.25
86 0.24
87 0.23
88 0.24
89 0.23
90 0.31
91 0.41
92 0.46
93 0.47
94 0.57