Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2G3U4

Protein Details
Accession A0A1Y2G3U4   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-103RHVCRCGSAVKHRSRRHRARCRLSDGSQCCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF12937  F-box-like  
Amino Acid Sequences MDNSLKARSPPPAQLDDEAPRPLPSLPTEILQRIIQLALPRLSFTTFRERYSILLTLCRVNKLWAALAQEELYRHVCRCGSAVKHRSRRHRARCRLSDGSQCCM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.41
4 0.41
5 0.35
6 0.3
7 0.26
8 0.24
9 0.22
10 0.19
11 0.17
12 0.18
13 0.17
14 0.18
15 0.2
16 0.2
17 0.22
18 0.2
19 0.18
20 0.14
21 0.13
22 0.12
23 0.11
24 0.13
25 0.12
26 0.12
27 0.12
28 0.12
29 0.14
30 0.13
31 0.15
32 0.22
33 0.22
34 0.23
35 0.24
36 0.24
37 0.24
38 0.26
39 0.25
40 0.16
41 0.16
42 0.16
43 0.18
44 0.19
45 0.19
46 0.16
47 0.15
48 0.16
49 0.15
50 0.15
51 0.13
52 0.15
53 0.14
54 0.15
55 0.14
56 0.14
57 0.13
58 0.14
59 0.15
60 0.14
61 0.14
62 0.15
63 0.15
64 0.15
65 0.17
66 0.21
67 0.25
68 0.35
69 0.44
70 0.51
71 0.61
72 0.68
73 0.77
74 0.82
75 0.86
76 0.87
77 0.89
78 0.9
79 0.91
80 0.92
81 0.9
82 0.87
83 0.82
84 0.81