Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2G0Z4

Protein Details
Accession A0A1Y2G0Z4    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
172-207LPHPRCPTSWRWQRPTPKPRARARRRKASIRCSSGLHydrophilic
211-246RFHVRGGRLGRRRRGGRRRKRGGRMRLGLRSWRRRLBasic
NLS Segment(s)
PositionSequence
185-248RPTPKPRARARRRKASIRCSSGLIRGRFHVRGGRLGRRRRGGRRRKRGGRMRLGLRSWRRRLGG
Subcellular Location(s) mito 18, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MRQRVMAVQVNSTRGRIIVEGVVKAPKGLPRDVGRTTSSSLIKHHLQCPLSRKRTYLQLPTKQQPTLPLELDTARAARAPRARLTQPADLPSVPTPRPKVLVSLHPGETQNLLPPPPSPREQVVFAPSAESARSALPPTPPLPPPPPHQLIIAENDLSIMCTSNSRLPPLLLPHPRCPTSWRWQRPTPKPRARARRRKASIRCSSGLIRGRFHVRGGRLGRRRRGGRRRKRGGRMRLGLRSWRRRLGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.18
4 0.17
5 0.17
6 0.19
7 0.19
8 0.21
9 0.23
10 0.21
11 0.21
12 0.21
13 0.2
14 0.21
15 0.22
16 0.27
17 0.3
18 0.36
19 0.39
20 0.4
21 0.39
22 0.38
23 0.38
24 0.37
25 0.35
26 0.3
27 0.29
28 0.31
29 0.35
30 0.37
31 0.39
32 0.4
33 0.39
34 0.42
35 0.49
36 0.54
37 0.55
38 0.52
39 0.51
40 0.47
41 0.55
42 0.57
43 0.58
44 0.58
45 0.59
46 0.66
47 0.7
48 0.71
49 0.62
50 0.56
51 0.52
52 0.47
53 0.42
54 0.36
55 0.3
56 0.27
57 0.27
58 0.27
59 0.21
60 0.16
61 0.12
62 0.13
63 0.12
64 0.15
65 0.2
66 0.22
67 0.25
68 0.3
69 0.31
70 0.36
71 0.4
72 0.41
73 0.38
74 0.37
75 0.35
76 0.3
77 0.3
78 0.27
79 0.26
80 0.21
81 0.23
82 0.24
83 0.23
84 0.26
85 0.24
86 0.25
87 0.24
88 0.29
89 0.29
90 0.3
91 0.3
92 0.3
93 0.3
94 0.26
95 0.25
96 0.18
97 0.17
98 0.14
99 0.12
100 0.1
101 0.11
102 0.14
103 0.16
104 0.18
105 0.17
106 0.19
107 0.21
108 0.22
109 0.23
110 0.22
111 0.2
112 0.17
113 0.16
114 0.14
115 0.12
116 0.1
117 0.09
118 0.07
119 0.06
120 0.07
121 0.07
122 0.09
123 0.1
124 0.12
125 0.13
126 0.16
127 0.16
128 0.2
129 0.24
130 0.25
131 0.29
132 0.34
133 0.36
134 0.33
135 0.34
136 0.32
137 0.29
138 0.29
139 0.26
140 0.18
141 0.15
142 0.14
143 0.13
144 0.11
145 0.09
146 0.06
147 0.05
148 0.06
149 0.07
150 0.13
151 0.14
152 0.16
153 0.16
154 0.16
155 0.19
156 0.23
157 0.3
158 0.33
159 0.37
160 0.42
161 0.47
162 0.48
163 0.46
164 0.46
165 0.44
166 0.47
167 0.53
168 0.55
169 0.57
170 0.64
171 0.74
172 0.8
173 0.84
174 0.84
175 0.83
176 0.83
177 0.86
178 0.89
179 0.9
180 0.9
181 0.89
182 0.89
183 0.88
184 0.89
185 0.89
186 0.89
187 0.87
188 0.83
189 0.76
190 0.69
191 0.63
192 0.6
193 0.58
194 0.5
195 0.42
196 0.39
197 0.43
198 0.4
199 0.4
200 0.38
201 0.33
202 0.39
203 0.44
204 0.5
205 0.53
206 0.62
207 0.67
208 0.71
209 0.78
210 0.8
211 0.84
212 0.85
213 0.87
214 0.89
215 0.92
216 0.93
217 0.94
218 0.94
219 0.94
220 0.93
221 0.91
222 0.89
223 0.87
224 0.82
225 0.81
226 0.81
227 0.81
228 0.77