Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FWS5

Protein Details
Accession A0A1Y2FWS5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MRSTRRRRKTPRARMMRSTRRLPSRARRRPSSAGEBasic
NLS Segment(s)
PositionSequence
5-40RRRRKTPRARMMRSTRRLPSRARRRPSSAGESPPHR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MRSTRRRRKTPRARMMRSTRRLPSRARRRPSSAGESPPHRPRCSSPAPAPPTRRSRFFLCLPPSLLRSIRDPTSITSSNINRSTSPAPQRPPGPLPCPPSPPASPLRPIPLPSAHQQPPPSTNSLNTPRIPLTSPSTTPQHPSSSSSSNSSSSNRPPPPLPLPTTNLSPTRSPTTLKHRRATSSTNRCLLPTGLLLTMALDTPSPPPPLPLPLLRPRPTPTSPPPHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.88
5 0.85
6 0.83
7 0.81
8 0.78
9 0.77
10 0.77
11 0.78
12 0.8
13 0.8
14 0.79
15 0.78
16 0.81
17 0.79
18 0.77
19 0.73
20 0.71
21 0.68
22 0.65
23 0.66
24 0.67
25 0.66
26 0.58
27 0.54
28 0.51
29 0.53
30 0.56
31 0.56
32 0.53
33 0.57
34 0.62
35 0.67
36 0.68
37 0.67
38 0.7
39 0.66
40 0.64
41 0.58
42 0.57
43 0.56
44 0.54
45 0.55
46 0.5
47 0.49
48 0.47
49 0.45
50 0.41
51 0.38
52 0.35
53 0.27
54 0.26
55 0.26
56 0.24
57 0.24
58 0.23
59 0.22
60 0.27
61 0.27
62 0.25
63 0.27
64 0.27
65 0.32
66 0.34
67 0.33
68 0.26
69 0.28
70 0.3
71 0.3
72 0.36
73 0.35
74 0.35
75 0.38
76 0.4
77 0.4
78 0.42
79 0.4
80 0.37
81 0.37
82 0.4
83 0.39
84 0.42
85 0.39
86 0.39
87 0.34
88 0.34
89 0.33
90 0.29
91 0.29
92 0.26
93 0.29
94 0.26
95 0.26
96 0.25
97 0.23
98 0.23
99 0.23
100 0.29
101 0.26
102 0.28
103 0.28
104 0.27
105 0.28
106 0.28
107 0.28
108 0.22
109 0.21
110 0.24
111 0.29
112 0.32
113 0.29
114 0.29
115 0.26
116 0.27
117 0.28
118 0.24
119 0.22
120 0.21
121 0.22
122 0.23
123 0.26
124 0.25
125 0.28
126 0.28
127 0.25
128 0.23
129 0.26
130 0.27
131 0.28
132 0.28
133 0.28
134 0.27
135 0.26
136 0.27
137 0.26
138 0.26
139 0.28
140 0.35
141 0.34
142 0.35
143 0.35
144 0.39
145 0.42
146 0.43
147 0.42
148 0.37
149 0.39
150 0.39
151 0.41
152 0.39
153 0.36
154 0.33
155 0.3
156 0.3
157 0.31
158 0.3
159 0.3
160 0.32
161 0.4
162 0.48
163 0.54
164 0.58
165 0.56
166 0.6
167 0.62
168 0.65
169 0.65
170 0.65
171 0.64
172 0.62
173 0.58
174 0.53
175 0.5
176 0.42
177 0.34
178 0.25
179 0.2
180 0.16
181 0.15
182 0.14
183 0.12
184 0.12
185 0.1
186 0.08
187 0.06
188 0.06
189 0.09
190 0.13
191 0.16
192 0.15
193 0.18
194 0.2
195 0.25
196 0.29
197 0.31
198 0.36
199 0.42
200 0.52
201 0.52
202 0.55
203 0.55
204 0.58
205 0.58
206 0.58
207 0.58