Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2G089

Protein Details
Accession A0A1Y2G089    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-34AVSTQGKAGKKKKWSKGKVKDKSNNAVICHydrophilic
NLS Segment(s)
PositionSequence
12-26KAGKKKKWSKGKVKD
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAAAVSTQGKAGKKKKWSKGKVKDKSNNAVICDKPTFDRIMKEVPTFKLISQSILIDRMKINGSLARVAIKHLEREGLIKPVVHHTAQLVYTRAIAADAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.63
4 0.68
5 0.75
6 0.81
7 0.84
8 0.88
9 0.91
10 0.91
11 0.91
12 0.9
13 0.87
14 0.85
15 0.81
16 0.73
17 0.65
18 0.6
19 0.5
20 0.45
21 0.38
22 0.31
23 0.24
24 0.23
25 0.23
26 0.19
27 0.2
28 0.18
29 0.22
30 0.23
31 0.24
32 0.25
33 0.23
34 0.24
35 0.23
36 0.21
37 0.22
38 0.2
39 0.19
40 0.16
41 0.16
42 0.14
43 0.17
44 0.17
45 0.12
46 0.12
47 0.13
48 0.13
49 0.12
50 0.13
51 0.11
52 0.12
53 0.12
54 0.12
55 0.13
56 0.12
57 0.13
58 0.17
59 0.16
60 0.17
61 0.17
62 0.18
63 0.16
64 0.19
65 0.2
66 0.19
67 0.18
68 0.17
69 0.18
70 0.22
71 0.26
72 0.23
73 0.22
74 0.2
75 0.23
76 0.23
77 0.25
78 0.21
79 0.18
80 0.19
81 0.18
82 0.17