Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2G5X5

Protein Details
Accession A0A1Y2G5X5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
40-59LVHARARRRFQRGLKRKPMABasic
NLS Segment(s)
PositionSequence
44-73RARRRFQRGLKRKPMALMKKLRKAKKEAAP
Subcellular Location(s) cyto 12, mito 8, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
IPR005713  Ribosomal_S19A/S15e  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
Amino Acid Sequences MNADEIAAANRRARTFKKFTYRGVELSQLLDLDSAAFTELVHARARRRFQRGLKRKPMALMKKLRKAKKEAAPGEKPECVKTHLRDMIIVPEMIGSVIGIYNGKVFNAVEIKPEMTGYYLAEFSISYKPVRHGRPGIGATHSSRFIPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.52
4 0.59
5 0.61
6 0.65
7 0.68
8 0.67
9 0.61
10 0.56
11 0.51
12 0.41
13 0.37
14 0.32
15 0.23
16 0.19
17 0.15
18 0.11
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.04
25 0.07
26 0.09
27 0.1
28 0.13
29 0.15
30 0.19
31 0.26
32 0.33
33 0.37
34 0.43
35 0.5
36 0.56
37 0.66
38 0.72
39 0.77
40 0.8
41 0.77
42 0.71
43 0.69
44 0.69
45 0.65
46 0.63
47 0.62
48 0.6
49 0.65
50 0.71
51 0.71
52 0.66
53 0.65
54 0.65
55 0.62
56 0.64
57 0.62
58 0.62
59 0.61
60 0.61
61 0.57
62 0.51
63 0.44
64 0.35
65 0.3
66 0.26
67 0.26
68 0.24
69 0.29
70 0.29
71 0.29
72 0.28
73 0.28
74 0.27
75 0.23
76 0.21
77 0.13
78 0.1
79 0.09
80 0.08
81 0.07
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.05
89 0.06
90 0.06
91 0.06
92 0.06
93 0.08
94 0.12
95 0.12
96 0.13
97 0.14
98 0.15
99 0.14
100 0.14
101 0.12
102 0.1
103 0.11
104 0.09
105 0.1
106 0.09
107 0.09
108 0.09
109 0.09
110 0.1
111 0.13
112 0.14
113 0.13
114 0.15
115 0.22
116 0.3
117 0.34
118 0.4
119 0.41
120 0.44
121 0.51
122 0.52
123 0.49
124 0.45
125 0.44
126 0.4
127 0.39
128 0.36
129 0.28