Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EP02

Protein Details
Accession A0A1Y2EP02   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
149-172SVPKRGPGRLKGSKNKPKPPPEADBasic
NLS Segment(s)
PositionSequence
133-169RRTCGRKTTKKPPADPSVPKRGPGRLKGSKNKPKPPP
Subcellular Location(s) mito 13, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MAQQPPKTIHHSHTTPPLLSPTWREVEELDDGLESDFRTCYLTLDFGSLVSMEAFEAADSFQLLVRGERHQALSRVGAQIFQGRHEELIGSELFFLPPKDDKTGFDPTPPAPNQSRIIFEPCNILSHEEAGRRRTCGRKTTKKPPADPSVPKRGPGRLKGSKNKPKPPPEADGGCSRGRRGYTSFCPTRVEAGQTFRQACDCCSCLGERWSFAIDEEQPVASGSGTRRGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.45
4 0.44
5 0.38
6 0.36
7 0.36
8 0.31
9 0.31
10 0.3
11 0.29
12 0.26
13 0.27
14 0.27
15 0.23
16 0.18
17 0.14
18 0.13
19 0.13
20 0.13
21 0.1
22 0.08
23 0.07
24 0.07
25 0.09
26 0.09
27 0.1
28 0.11
29 0.12
30 0.12
31 0.13
32 0.13
33 0.11
34 0.11
35 0.1
36 0.09
37 0.07
38 0.06
39 0.04
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.07
51 0.08
52 0.1
53 0.12
54 0.14
55 0.15
56 0.18
57 0.2
58 0.22
59 0.22
60 0.22
61 0.22
62 0.23
63 0.21
64 0.19
65 0.16
66 0.19
67 0.18
68 0.17
69 0.17
70 0.14
71 0.14
72 0.14
73 0.13
74 0.08
75 0.1
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.09
85 0.11
86 0.14
87 0.15
88 0.16
89 0.21
90 0.27
91 0.26
92 0.25
93 0.25
94 0.23
95 0.29
96 0.28
97 0.27
98 0.21
99 0.24
100 0.26
101 0.25
102 0.27
103 0.21
104 0.25
105 0.22
106 0.21
107 0.21
108 0.18
109 0.18
110 0.16
111 0.16
112 0.12
113 0.13
114 0.15
115 0.16
116 0.18
117 0.21
118 0.21
119 0.22
120 0.26
121 0.31
122 0.34
123 0.39
124 0.48
125 0.54
126 0.62
127 0.71
128 0.76
129 0.77
130 0.78
131 0.76
132 0.74
133 0.71
134 0.72
135 0.67
136 0.69
137 0.62
138 0.6
139 0.55
140 0.53
141 0.52
142 0.5
143 0.53
144 0.51
145 0.59
146 0.66
147 0.75
148 0.78
149 0.81
150 0.83
151 0.83
152 0.83
153 0.83
154 0.78
155 0.73
156 0.69
157 0.64
158 0.57
159 0.54
160 0.49
161 0.44
162 0.39
163 0.34
164 0.31
165 0.28
166 0.29
167 0.27
168 0.31
169 0.34
170 0.43
171 0.45
172 0.44
173 0.46
174 0.43
175 0.44
176 0.38
177 0.36
178 0.3
179 0.32
180 0.36
181 0.38
182 0.39
183 0.34
184 0.37
185 0.32
186 0.31
187 0.31
188 0.27
189 0.22
190 0.23
191 0.24
192 0.24
193 0.29
194 0.3
195 0.25
196 0.27
197 0.27
198 0.25
199 0.25
200 0.25
201 0.21
202 0.22
203 0.21
204 0.19
205 0.17
206 0.18
207 0.17
208 0.12
209 0.14
210 0.13