Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FHS0

Protein Details
Accession A0A1Y2FHS0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-90MELIRNSKDKKARKLTKKRLGTLRRAKRKVDBasic
NLS Segment(s)
PositionSequence
65-88NSKDKKARKLTKKRLGTLRRAKRK
Subcellular Location(s) mito 15, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MSAAPRSNLPWGPNKGHPTTVIALAGKPSNRKGKQSARSEFVKNIVREVAGFAPYERRVMELIRNSKDKKARKLTKKRLGTLRRAKRKVDELTGVIAEQRRHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.48
4 0.45
5 0.41
6 0.37
7 0.33
8 0.28
9 0.22
10 0.19
11 0.19
12 0.21
13 0.18
14 0.19
15 0.23
16 0.31
17 0.33
18 0.38
19 0.45
20 0.52
21 0.59
22 0.66
23 0.65
24 0.59
25 0.61
26 0.59
27 0.52
28 0.48
29 0.45
30 0.35
31 0.31
32 0.27
33 0.23
34 0.2
35 0.2
36 0.15
37 0.09
38 0.09
39 0.08
40 0.11
41 0.11
42 0.12
43 0.1
44 0.1
45 0.1
46 0.12
47 0.17
48 0.21
49 0.27
50 0.3
51 0.35
52 0.36
53 0.42
54 0.49
55 0.51
56 0.54
57 0.59
58 0.65
59 0.71
60 0.81
61 0.86
62 0.88
63 0.89
64 0.87
65 0.86
66 0.84
67 0.84
68 0.84
69 0.83
70 0.84
71 0.81
72 0.77
73 0.74
74 0.75
75 0.71
76 0.67
77 0.62
78 0.52
79 0.51
80 0.47
81 0.4
82 0.34
83 0.31
84 0.25