Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EZ75

Protein Details
Accession A0A1Y2EZ75   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-27FTGISKARTFKPRKNVPDNTRAFQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12, nucl 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005301  MOB_kinase_act_fam  
IPR036703  MOB_kinase_act_sf  
Pfam View protein in Pfam  
PF03637  Mob1_phocein  
Amino Acid Sequences MSFFTGISKARTFKPRKNVPDNTRAFQLKKYAEATLGSGNLRLAVVLPEGEDLNEWLAVNTVDFFNQINMLYGTVTEFCTPQECPIMCAGPRFEYHWQDGVNFKKPTRFSAPEYVDHLMNWVQAMLDDEAIFPSKIGVSFPKSFQSTIKSIVRRLFRVYAHLYNHHFAQLCALSIEAHINTSYRHFLMFVTEFNLVEKKELAPLAELNESILNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.74
4 0.81
5 0.85
6 0.82
7 0.85
8 0.83
9 0.76
10 0.73
11 0.68
12 0.59
13 0.52
14 0.53
15 0.44
16 0.43
17 0.41
18 0.35
19 0.32
20 0.31
21 0.29
22 0.23
23 0.23
24 0.18
25 0.16
26 0.15
27 0.14
28 0.13
29 0.1
30 0.08
31 0.07
32 0.07
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.05
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.09
67 0.09
68 0.1
69 0.15
70 0.14
71 0.15
72 0.16
73 0.18
74 0.16
75 0.18
76 0.18
77 0.14
78 0.14
79 0.16
80 0.19
81 0.2
82 0.22
83 0.23
84 0.22
85 0.21
86 0.25
87 0.25
88 0.29
89 0.28
90 0.26
91 0.28
92 0.29
93 0.33
94 0.35
95 0.35
96 0.32
97 0.4
98 0.42
99 0.39
100 0.42
101 0.39
102 0.31
103 0.27
104 0.24
105 0.15
106 0.12
107 0.1
108 0.06
109 0.05
110 0.05
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.08
118 0.07
119 0.05
120 0.05
121 0.05
122 0.06
123 0.07
124 0.09
125 0.14
126 0.16
127 0.17
128 0.22
129 0.23
130 0.24
131 0.25
132 0.27
133 0.23
134 0.28
135 0.33
136 0.31
137 0.33
138 0.38
139 0.41
140 0.38
141 0.4
142 0.39
143 0.33
144 0.37
145 0.39
146 0.39
147 0.38
148 0.42
149 0.41
150 0.38
151 0.38
152 0.35
153 0.3
154 0.23
155 0.24
156 0.19
157 0.16
158 0.15
159 0.14
160 0.11
161 0.11
162 0.14
163 0.09
164 0.09
165 0.09
166 0.09
167 0.1
168 0.13
169 0.16
170 0.14
171 0.14
172 0.13
173 0.13
174 0.19
175 0.2
176 0.18
177 0.18
178 0.19
179 0.18
180 0.2
181 0.23
182 0.17
183 0.17
184 0.17
185 0.15
186 0.18
187 0.19
188 0.18
189 0.17
190 0.19
191 0.21
192 0.21
193 0.2
194 0.18