Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EWZ1

Protein Details
Accession A0A1Y2EWZ1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-72DGKGNKQKTSEKRKLQNRQAQRNFREHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MPRAVPLATAGHEKRKGDTKGGALKDRRASGGASTGAHTHNEEEDDDGKGNKQKTSEKRKLQNRQAQRNFRERKEKVSCPSSPAAPRASQGTRGSCVELGAADYGAGNRERRPQAATRAIAERE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.46
4 0.43
5 0.45
6 0.45
7 0.49
8 0.53
9 0.57
10 0.51
11 0.55
12 0.55
13 0.52
14 0.45
15 0.37
16 0.33
17 0.26
18 0.28
19 0.23
20 0.18
21 0.17
22 0.17
23 0.17
24 0.17
25 0.16
26 0.12
27 0.11
28 0.12
29 0.11
30 0.12
31 0.12
32 0.12
33 0.12
34 0.12
35 0.13
36 0.16
37 0.17
38 0.16
39 0.18
40 0.25
41 0.34
42 0.45
43 0.53
44 0.57
45 0.65
46 0.74
47 0.8
48 0.82
49 0.81
50 0.8
51 0.82
52 0.83
53 0.82
54 0.78
55 0.78
56 0.74
57 0.71
58 0.71
59 0.61
60 0.62
61 0.61
62 0.61
63 0.57
64 0.58
65 0.54
66 0.48
67 0.49
68 0.44
69 0.39
70 0.36
71 0.33
72 0.27
73 0.27
74 0.28
75 0.27
76 0.29
77 0.3
78 0.3
79 0.3
80 0.3
81 0.31
82 0.26
83 0.24
84 0.18
85 0.14
86 0.12
87 0.09
88 0.08
89 0.06
90 0.06
91 0.06
92 0.08
93 0.11
94 0.11
95 0.13
96 0.22
97 0.26
98 0.28
99 0.33
100 0.37
101 0.44
102 0.51
103 0.52
104 0.47