Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2DF28

Protein Details
Accession A0A1Y2DF28    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-45AASARFRAKKKQRDQQLQQTSIHydrophilic
NLS Segment(s)
PositionSequence
19-34RRRNTAASARFRAKKK
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences MDPGPLQNGTPEEIEEDKRRRNTAASARFRAKKKQRDQQLQQTSIQLREKVQDLEKEKTSLKAENTWLRDLVSERSEISPKIRELLISQKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.32
4 0.37
5 0.41
6 0.43
7 0.41
8 0.41
9 0.45
10 0.48
11 0.53
12 0.53
13 0.55
14 0.6
15 0.66
16 0.66
17 0.68
18 0.67
19 0.67
20 0.68
21 0.71
22 0.75
23 0.78
24 0.83
25 0.83
26 0.83
27 0.75
28 0.66
29 0.62
30 0.52
31 0.46
32 0.4
33 0.3
34 0.21
35 0.2
36 0.2
37 0.19
38 0.2
39 0.22
40 0.25
41 0.28
42 0.29
43 0.3
44 0.29
45 0.31
46 0.3
47 0.28
48 0.25
49 0.26
50 0.31
51 0.36
52 0.39
53 0.37
54 0.35
55 0.31
56 0.3
57 0.28
58 0.26
59 0.2
60 0.18
61 0.18
62 0.21
63 0.22
64 0.22
65 0.24
66 0.26
67 0.25
68 0.27
69 0.26
70 0.24
71 0.25