Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2G129

Protein Details
Accession A0A1Y2G129   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
102-123LEKPTNKKAKGRKEPFKARVVVHydrophilic
NLS Segment(s)
PositionSequence
73-118AAKPARRAKERAMKKEKAAEKRKLIELGVLEKPTNKKAKGRKEPFK
361-371GPGGRKGRRGK
Subcellular Location(s) cyto 12, cyto_nucl 10, mito 9, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR028564  MT_TRM10-typ  
IPR038459  MT_TRM10-typ_sf  
IPR007356  tRNA_m1G_MeTrfase_euk  
IPR016009  tRNA_MeTrfase_TRMD/TRM10  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01746  tRNA_m1G_MT  
PROSITE View protein in PROSITE  
PS51675  SAM_MT_TRM10  
CDD cd18089  SPOUT_Trm10-like  
Amino Acid Sequences MSAHPSLPPAAPAPAEAAAPASIPSAETEAAPIASTSSAPSHNTAPNPFLADMPAGLSKNAQKRWLKQAAFDAAKPARRAKERAMKKEKAAEKRKLIELGVLEKPTNKKAKGRKEPFKARVVVDCAFDDKMTEKEVKSMAAQLAFCYSSNRASSRPLDLLISGLSGRMKEKFESTPNKPHEAWKGVEWWEEGYEELWAEPTPSSSAETIPPPPADASTTTDAPSTTEAPPTTTAATPSSTVPPVSLGFFAGQPRSRVPKSSIIYLTGDSPNVLTTIEEDKTYILGGIVDRNRYKKLCFDKAEAQGITHAQLPIGQFMPDMPTRKVLTVNQVYDILLQYVETKDWTSALQAVMPTRKMEHGGPGGRKGRRGKDGEVVEGAEGEGEGESGEDGEEVEGKAVYEVKSGDEMEVEAEKGEMGVEAEVASKSEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.14
4 0.14
5 0.11
6 0.11
7 0.11
8 0.09
9 0.08
10 0.08
11 0.09
12 0.1
13 0.1
14 0.1
15 0.11
16 0.11
17 0.12
18 0.11
19 0.1
20 0.08
21 0.09
22 0.09
23 0.09
24 0.11
25 0.13
26 0.15
27 0.18
28 0.22
29 0.26
30 0.3
31 0.32
32 0.31
33 0.31
34 0.33
35 0.31
36 0.26
37 0.22
38 0.19
39 0.16
40 0.16
41 0.17
42 0.14
43 0.13
44 0.16
45 0.21
46 0.29
47 0.32
48 0.38
49 0.42
50 0.47
51 0.58
52 0.65
53 0.59
54 0.56
55 0.6
56 0.61
57 0.57
58 0.51
59 0.49
60 0.44
61 0.48
62 0.46
63 0.45
64 0.43
65 0.46
66 0.5
67 0.52
68 0.58
69 0.63
70 0.71
71 0.75
72 0.73
73 0.72
74 0.77
75 0.75
76 0.76
77 0.75
78 0.73
79 0.72
80 0.72
81 0.71
82 0.64
83 0.56
84 0.49
85 0.42
86 0.38
87 0.33
88 0.29
89 0.25
90 0.27
91 0.29
92 0.33
93 0.38
94 0.35
95 0.4
96 0.48
97 0.59
98 0.66
99 0.73
100 0.76
101 0.8
102 0.87
103 0.86
104 0.84
105 0.77
106 0.68
107 0.63
108 0.58
109 0.49
110 0.4
111 0.34
112 0.28
113 0.24
114 0.22
115 0.17
116 0.13
117 0.12
118 0.13
119 0.15
120 0.13
121 0.16
122 0.17
123 0.17
124 0.17
125 0.19
126 0.18
127 0.18
128 0.17
129 0.14
130 0.16
131 0.15
132 0.15
133 0.14
134 0.13
135 0.14
136 0.16
137 0.17
138 0.17
139 0.21
140 0.23
141 0.24
142 0.24
143 0.22
144 0.2
145 0.18
146 0.18
147 0.13
148 0.12
149 0.08
150 0.07
151 0.07
152 0.07
153 0.08
154 0.1
155 0.11
156 0.12
157 0.15
158 0.18
159 0.25
160 0.33
161 0.37
162 0.44
163 0.47
164 0.51
165 0.48
166 0.49
167 0.48
168 0.44
169 0.4
170 0.31
171 0.32
172 0.28
173 0.29
174 0.25
175 0.19
176 0.15
177 0.14
178 0.12
179 0.08
180 0.07
181 0.06
182 0.05
183 0.05
184 0.04
185 0.05
186 0.05
187 0.05
188 0.06
189 0.06
190 0.08
191 0.08
192 0.09
193 0.1
194 0.11
195 0.12
196 0.13
197 0.13
198 0.12
199 0.12
200 0.11
201 0.11
202 0.11
203 0.13
204 0.13
205 0.14
206 0.14
207 0.14
208 0.14
209 0.13
210 0.13
211 0.12
212 0.1
213 0.12
214 0.12
215 0.13
216 0.14
217 0.14
218 0.14
219 0.12
220 0.13
221 0.11
222 0.12
223 0.12
224 0.12
225 0.13
226 0.12
227 0.12
228 0.11
229 0.11
230 0.11
231 0.1
232 0.09
233 0.08
234 0.08
235 0.09
236 0.11
237 0.12
238 0.13
239 0.14
240 0.16
241 0.22
242 0.22
243 0.24
244 0.27
245 0.33
246 0.33
247 0.38
248 0.37
249 0.33
250 0.33
251 0.31
252 0.3
253 0.22
254 0.2
255 0.13
256 0.12
257 0.1
258 0.09
259 0.08
260 0.05
261 0.07
262 0.1
263 0.11
264 0.1
265 0.1
266 0.1
267 0.11
268 0.11
269 0.08
270 0.05
271 0.05
272 0.06
273 0.11
274 0.13
275 0.18
276 0.2
277 0.23
278 0.27
279 0.28
280 0.29
281 0.32
282 0.39
283 0.44
284 0.46
285 0.49
286 0.53
287 0.57
288 0.62
289 0.53
290 0.45
291 0.37
292 0.33
293 0.28
294 0.22
295 0.17
296 0.1
297 0.12
298 0.12
299 0.13
300 0.13
301 0.12
302 0.09
303 0.09
304 0.14
305 0.15
306 0.18
307 0.17
308 0.22
309 0.23
310 0.24
311 0.28
312 0.26
313 0.32
314 0.36
315 0.36
316 0.33
317 0.32
318 0.31
319 0.29
320 0.27
321 0.18
322 0.1
323 0.09
324 0.09
325 0.09
326 0.09
327 0.09
328 0.09
329 0.09
330 0.1
331 0.1
332 0.1
333 0.12
334 0.12
335 0.13
336 0.14
337 0.17
338 0.21
339 0.22
340 0.21
341 0.2
342 0.22
343 0.23
344 0.22
345 0.25
346 0.29
347 0.36
348 0.38
349 0.45
350 0.51
351 0.51
352 0.57
353 0.58
354 0.58
355 0.6
356 0.62
357 0.58
358 0.59
359 0.6
360 0.56
361 0.5
362 0.42
363 0.33
364 0.28
365 0.23
366 0.14
367 0.1
368 0.07
369 0.05
370 0.04
371 0.04
372 0.04
373 0.04
374 0.04
375 0.04
376 0.04
377 0.04
378 0.05
379 0.06
380 0.06
381 0.07
382 0.07
383 0.07
384 0.08
385 0.11
386 0.11
387 0.12
388 0.13
389 0.14
390 0.17
391 0.17
392 0.17
393 0.14
394 0.14
395 0.14
396 0.15
397 0.13
398 0.1
399 0.1
400 0.09
401 0.08
402 0.08
403 0.06
404 0.06
405 0.05
406 0.06
407 0.06
408 0.08
409 0.08