Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AW07

Protein Details
Accession G3AW07   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-57KLNVPKPPKVTNPNKIQKLKHydrophilic
243-265PFEDVYRRFRPRKINHRVMNDIEHydrophilic
NLS Segment(s)
PositionSequence
33-46KLPKIKLNVPKPPK
Subcellular Location(s) cyto 12.5, cyto_nucl 11.5, nucl 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037817  TAF7  
IPR006751  TAFII55_prot_cons_reg  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
KEGG cten:CANTEDRAFT_101042  -  
Pfam View protein in Pfam  
PF04658  TAFII55_N  
Amino Acid Sequences MAPLKLKLKIGGTGGSSNNSGETASKSSKAPTKLPKIKLNVPKPPKVTNPNKIQKLKISLGPKKTHQLDAIGIEGVTSQVKRVPKVRIKPTRVPGEGYDSETPDMEDDPLIENGIIIRFLNDINLDHVHNAVGANDFSGINVKWLTKEKALVNVKGSIYSARLVDLPTISEVFKTIDKKNIFKILDLCQMLLVIKPVTPNDLNLETDFEVPSKSHYKHPLYNISPGHEIKETRPVLRDGLTQPFEDVYRRFRPRKINHRVMNDIEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.27
4 0.24
5 0.22
6 0.18
7 0.16
8 0.12
9 0.15
10 0.18
11 0.2
12 0.22
13 0.22
14 0.27
15 0.34
16 0.37
17 0.41
18 0.46
19 0.54
20 0.61
21 0.68
22 0.71
23 0.71
24 0.76
25 0.78
26 0.78
27 0.77
28 0.75
29 0.76
30 0.73
31 0.72
32 0.71
33 0.71
34 0.72
35 0.71
36 0.74
37 0.76
38 0.81
39 0.79
40 0.74
41 0.7
42 0.68
43 0.62
44 0.58
45 0.58
46 0.55
47 0.59
48 0.6
49 0.57
50 0.58
51 0.58
52 0.55
53 0.46
54 0.42
55 0.36
56 0.33
57 0.3
58 0.22
59 0.18
60 0.14
61 0.12
62 0.1
63 0.08
64 0.06
65 0.06
66 0.09
67 0.12
68 0.15
69 0.2
70 0.29
71 0.36
72 0.46
73 0.56
74 0.63
75 0.68
76 0.74
77 0.77
78 0.77
79 0.7
80 0.63
81 0.54
82 0.51
83 0.45
84 0.41
85 0.34
86 0.26
87 0.25
88 0.22
89 0.2
90 0.13
91 0.12
92 0.08
93 0.07
94 0.06
95 0.07
96 0.07
97 0.07
98 0.07
99 0.06
100 0.06
101 0.06
102 0.06
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.06
109 0.06
110 0.08
111 0.09
112 0.09
113 0.08
114 0.09
115 0.08
116 0.08
117 0.07
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.07
126 0.06
127 0.06
128 0.07
129 0.07
130 0.08
131 0.12
132 0.15
133 0.14
134 0.18
135 0.18
136 0.27
137 0.3
138 0.3
139 0.29
140 0.3
141 0.29
142 0.25
143 0.25
144 0.16
145 0.14
146 0.13
147 0.11
148 0.08
149 0.09
150 0.09
151 0.09
152 0.09
153 0.08
154 0.08
155 0.09
156 0.08
157 0.08
158 0.08
159 0.09
160 0.12
161 0.15
162 0.16
163 0.24
164 0.27
165 0.29
166 0.33
167 0.4
168 0.37
169 0.35
170 0.37
171 0.34
172 0.38
173 0.36
174 0.31
175 0.23
176 0.23
177 0.21
178 0.17
179 0.14
180 0.07
181 0.08
182 0.09
183 0.09
184 0.14
185 0.14
186 0.15
187 0.18
188 0.19
189 0.2
190 0.19
191 0.22
192 0.19
193 0.19
194 0.19
195 0.14
196 0.13
197 0.11
198 0.15
199 0.19
200 0.2
201 0.26
202 0.35
203 0.41
204 0.47
205 0.54
206 0.6
207 0.56
208 0.63
209 0.58
210 0.53
211 0.52
212 0.46
213 0.42
214 0.36
215 0.34
216 0.28
217 0.36
218 0.34
219 0.31
220 0.34
221 0.33
222 0.32
223 0.32
224 0.36
225 0.29
226 0.36
227 0.35
228 0.32
229 0.32
230 0.3
231 0.29
232 0.27
233 0.26
234 0.25
235 0.33
236 0.41
237 0.46
238 0.51
239 0.61
240 0.68
241 0.76
242 0.8
243 0.81
244 0.81
245 0.84
246 0.85
247 0.79