Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CC86

Protein Details
Accession A0A1Y2CC86   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
81-100HSCYRPRKDGERKRKSVRGCBasic
181-212LVTPERLQRRRHLRSLKRRKTEQQKVQVAEYKHydrophilic
NLS Segment(s)
PositionSequence
87-95RKDGERKRK
135-138PKRA
184-200PERLQRRRHLRSLKRRK
Subcellular Location(s) nucl 14.5, cyto_nucl 13.833, cyto 11, mito_nucl 8.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLNFANPATGQQKSVEIDDERRTRIFYEKRMAQEVAVDSLGDEFKGYVVRITGGNDKQGFPLKQGVLVPHRVKLLLAKGHSCYRPRKDGERKRKSVRGCIVGADVRALSLVVVKQGEADIPGLTDQVLPKRLGPKRATKIRRFFNLEKSDDVRKFVIRREVTSKTEGAKPYTKAPKIQRLVTPERLQRRRHLRSLKRRKTEQQKVQVAEYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.25
4 0.24
5 0.28
6 0.36
7 0.39
8 0.38
9 0.37
10 0.36
11 0.34
12 0.4
13 0.42
14 0.41
15 0.46
16 0.49
17 0.53
18 0.56
19 0.55
20 0.45
21 0.43
22 0.37
23 0.3
24 0.23
25 0.19
26 0.14
27 0.14
28 0.14
29 0.09
30 0.08
31 0.05
32 0.06
33 0.07
34 0.07
35 0.07
36 0.07
37 0.09
38 0.09
39 0.12
40 0.19
41 0.18
42 0.24
43 0.24
44 0.25
45 0.26
46 0.32
47 0.3
48 0.25
49 0.3
50 0.24
51 0.26
52 0.26
53 0.28
54 0.24
55 0.32
56 0.31
57 0.27
58 0.27
59 0.25
60 0.24
61 0.23
62 0.25
63 0.21
64 0.22
65 0.21
66 0.24
67 0.29
68 0.32
69 0.34
70 0.37
71 0.37
72 0.44
73 0.46
74 0.53
75 0.6
76 0.67
77 0.74
78 0.76
79 0.79
80 0.78
81 0.8
82 0.74
83 0.72
84 0.67
85 0.6
86 0.5
87 0.43
88 0.38
89 0.33
90 0.29
91 0.2
92 0.14
93 0.08
94 0.08
95 0.06
96 0.04
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.04
108 0.05
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.09
115 0.11
116 0.12
117 0.14
118 0.23
119 0.26
120 0.33
121 0.36
122 0.43
123 0.5
124 0.6
125 0.67
126 0.68
127 0.73
128 0.73
129 0.76
130 0.75
131 0.69
132 0.69
133 0.68
134 0.61
135 0.57
136 0.53
137 0.53
138 0.46
139 0.45
140 0.37
141 0.33
142 0.33
143 0.34
144 0.4
145 0.33
146 0.37
147 0.41
148 0.44
149 0.44
150 0.45
151 0.42
152 0.36
153 0.4
154 0.38
155 0.36
156 0.36
157 0.35
158 0.4
159 0.48
160 0.48
161 0.5
162 0.56
163 0.61
164 0.61
165 0.65
166 0.61
167 0.6
168 0.65
169 0.65
170 0.65
171 0.63
172 0.68
173 0.7
174 0.69
175 0.7
176 0.73
177 0.73
178 0.75
179 0.78
180 0.79
181 0.83
182 0.9
183 0.91
184 0.9
185 0.9
186 0.91
187 0.91
188 0.91
189 0.91
190 0.9
191 0.88
192 0.82