Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2F2E6

Protein Details
Accession A0A1Y2F2E6   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
218-245EGEEKGKGKPEKKATKKRKSGAKEEEEGBasic
NLS Segment(s)
PositionSequence
206-240GKGKGKGKKEEEEGEEKGKGKPEKKATKKRKSGAK
259-267SSRPSKKRK
Subcellular Location(s) cyto_nucl 10.5, nucl 10, mito 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002740  EVE_domain  
IPR015947  PUA-like_sf  
IPR047197  THYN1-like_EVE  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01878  EVE  
CDD cd21133  EVE  
Amino Acid Sequences MAPKKASTASSAAEEPTYTHWLLKAEPETRIEKGVDVKFSIDDFEACKVTSWEGVRNHEAKKIMKEKMQLGQKCLFYASNCKVPGITGLAKVVKTGYPDHNAWDPKHPYFDPKSDPKNPTWYMVDLEFTLRLPHLVPLKLLQSLSTLTTPPSCTPYLTPSHLSAIANSALIKRGRLSVQPASEKFYEAVRLLGEEGGWEGLMPAAGKGKGKGKKEEEEGEEKGKGKPEKKATKKRKSGAKEEEEGDEEEEEEVIPKGSSSRPSKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.2
4 0.22
5 0.19
6 0.18
7 0.19
8 0.2
9 0.21
10 0.26
11 0.29
12 0.27
13 0.29
14 0.33
15 0.35
16 0.35
17 0.37
18 0.3
19 0.26
20 0.31
21 0.32
22 0.3
23 0.27
24 0.27
25 0.25
26 0.25
27 0.24
28 0.17
29 0.14
30 0.13
31 0.14
32 0.14
33 0.13
34 0.14
35 0.13
36 0.14
37 0.17
38 0.18
39 0.22
40 0.25
41 0.3
42 0.35
43 0.39
44 0.39
45 0.39
46 0.42
47 0.39
48 0.44
49 0.46
50 0.45
51 0.45
52 0.49
53 0.49
54 0.51
55 0.57
56 0.5
57 0.47
58 0.48
59 0.44
60 0.4
61 0.37
62 0.31
63 0.23
64 0.29
65 0.28
66 0.29
67 0.28
68 0.28
69 0.26
70 0.25
71 0.26
72 0.22
73 0.2
74 0.14
75 0.16
76 0.18
77 0.18
78 0.17
79 0.17
80 0.13
81 0.13
82 0.16
83 0.18
84 0.2
85 0.21
86 0.23
87 0.28
88 0.31
89 0.3
90 0.34
91 0.35
92 0.31
93 0.35
94 0.33
95 0.33
96 0.34
97 0.37
98 0.35
99 0.39
100 0.45
101 0.48
102 0.51
103 0.47
104 0.52
105 0.48
106 0.45
107 0.4
108 0.33
109 0.27
110 0.24
111 0.22
112 0.14
113 0.14
114 0.11
115 0.09
116 0.08
117 0.06
118 0.06
119 0.06
120 0.08
121 0.1
122 0.1
123 0.11
124 0.12
125 0.13
126 0.14
127 0.13
128 0.11
129 0.09
130 0.09
131 0.1
132 0.1
133 0.09
134 0.08
135 0.1
136 0.11
137 0.11
138 0.14
139 0.13
140 0.13
141 0.14
142 0.17
143 0.2
144 0.21
145 0.23
146 0.2
147 0.22
148 0.23
149 0.22
150 0.18
151 0.16
152 0.14
153 0.12
154 0.11
155 0.1
156 0.12
157 0.12
158 0.12
159 0.11
160 0.13
161 0.15
162 0.17
163 0.22
164 0.23
165 0.29
166 0.35
167 0.35
168 0.36
169 0.35
170 0.34
171 0.29
172 0.24
173 0.22
174 0.16
175 0.16
176 0.12
177 0.12
178 0.11
179 0.1
180 0.09
181 0.06
182 0.06
183 0.06
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.07
192 0.08
193 0.1
194 0.12
195 0.2
196 0.26
197 0.31
198 0.4
199 0.44
200 0.49
201 0.55
202 0.59
203 0.56
204 0.56
205 0.55
206 0.5
207 0.47
208 0.41
209 0.38
210 0.38
211 0.4
212 0.38
213 0.43
214 0.5
215 0.59
216 0.68
217 0.77
218 0.81
219 0.85
220 0.91
221 0.9
222 0.9
223 0.87
224 0.87
225 0.86
226 0.83
227 0.78
228 0.7
229 0.65
230 0.57
231 0.5
232 0.41
233 0.31
234 0.23
235 0.17
236 0.15
237 0.11
238 0.1
239 0.09
240 0.08
241 0.07
242 0.07
243 0.1
244 0.13
245 0.22
246 0.3
247 0.41