Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CZ96

Protein Details
Accession A0A1Y2CZ96    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
181-207LIWESNTEQPKKKKKRKHDHDAGGGGGBasic
209-233AGAGNDEHRKKKKRKGGGGHGDGSPBasic
NLS Segment(s)
PositionSequence
190-228PKKKKKRKHDHDAGGGGGAAGAGNDEHRKKKKRKGGGGH
Subcellular Location(s) cyto 11cyto_nucl 11, nucl 9, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MDSSAPAQQQHAPEAGPSRLPPPLAEYLIPLGNTRASPLSGSQDLISLFGLSPVYDTFLRPYLPESVTGAAGEGEDLKGKGKEKAVETPGGGAGAPKSIGITLGGVRIGEVDKPKKAKMEKQYSHLIQDIPGRNTIKKDHYIRDLVLNPDVQPPHIVPFDEQTLRDAFTLKPGQIPGFDALIWESNTEQPKKKKKRKHDHDAGGGGGAAGAGNDEHRKKKKRKGGGGHGDGSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.23
4 0.22
5 0.22
6 0.23
7 0.23
8 0.21
9 0.22
10 0.26
11 0.26
12 0.25
13 0.24
14 0.24
15 0.25
16 0.25
17 0.2
18 0.16
19 0.16
20 0.15
21 0.15
22 0.14
23 0.13
24 0.13
25 0.15
26 0.19
27 0.18
28 0.19
29 0.17
30 0.18
31 0.17
32 0.17
33 0.15
34 0.1
35 0.09
36 0.09
37 0.09
38 0.06
39 0.07
40 0.07
41 0.09
42 0.09
43 0.1
44 0.11
45 0.13
46 0.14
47 0.13
48 0.15
49 0.17
50 0.17
51 0.18
52 0.18
53 0.17
54 0.17
55 0.16
56 0.14
57 0.09
58 0.08
59 0.07
60 0.06
61 0.05
62 0.05
63 0.05
64 0.07
65 0.09
66 0.1
67 0.13
68 0.16
69 0.2
70 0.22
71 0.29
72 0.3
73 0.3
74 0.29
75 0.27
76 0.24
77 0.2
78 0.17
79 0.1
80 0.08
81 0.06
82 0.06
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.05
91 0.06
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.1
98 0.12
99 0.15
100 0.17
101 0.19
102 0.23
103 0.26
104 0.32
105 0.38
106 0.47
107 0.47
108 0.49
109 0.56
110 0.52
111 0.51
112 0.45
113 0.35
114 0.26
115 0.3
116 0.29
117 0.23
118 0.26
119 0.25
120 0.25
121 0.27
122 0.29
123 0.26
124 0.3
125 0.33
126 0.33
127 0.37
128 0.38
129 0.37
130 0.39
131 0.37
132 0.31
133 0.28
134 0.25
135 0.21
136 0.22
137 0.22
138 0.16
139 0.15
140 0.14
141 0.15
142 0.16
143 0.15
144 0.12
145 0.14
146 0.18
147 0.18
148 0.18
149 0.17
150 0.17
151 0.17
152 0.17
153 0.16
154 0.12
155 0.17
156 0.2
157 0.18
158 0.2
159 0.2
160 0.21
161 0.2
162 0.22
163 0.17
164 0.15
165 0.14
166 0.12
167 0.12
168 0.13
169 0.13
170 0.11
171 0.1
172 0.14
173 0.21
174 0.25
175 0.32
176 0.39
177 0.5
178 0.61
179 0.7
180 0.76
181 0.81
182 0.89
183 0.92
184 0.94
185 0.94
186 0.92
187 0.91
188 0.84
189 0.73
190 0.62
191 0.51
192 0.39
193 0.28
194 0.18
195 0.08
196 0.04
197 0.04
198 0.03
199 0.06
200 0.12
201 0.17
202 0.26
203 0.36
204 0.47
205 0.56
206 0.67
207 0.75
208 0.8
209 0.86
210 0.88
211 0.9
212 0.91
213 0.89