Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2G6N9

Protein Details
Accession A0A1Y2G6N9   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-153SGDDSTKSKSKKKSKKAAAEDDESEHydrophilic
NLS Segment(s)
PositionSequence
135-145KSKSKKKSKKA
Subcellular Location(s) nucl 20.5, mito_nucl 13, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR002119  Histone_H2A  
IPR007125  Histone_H2A/H2B/H3  
IPR032454  Histone_H2A_C  
IPR032458  Histone_H2A_CS  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PF16211  Histone_H2A_C  
PROSITE View protein in PROSITE  
PS00046  HISTONE_H2A  
CDD cd00074  H2A  
Amino Acid Sequences MKTTGGKSTKTGNGETERISRSTRAGLTFPVGRVDTQLRKGRYAARVGQGAPVYLAAVMEYLVAEILELAGNAARDNKKKRIIPRHVQLAIRNDEELDKLLSHVNISQGGVLPNIHPTLLPRKTPKGSSGDDSTKSKSKKKSKKAAAEDDESEEEQEAQTFPKGVSMEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.42
4 0.38
5 0.36
6 0.37
7 0.32
8 0.28
9 0.31
10 0.3
11 0.27
12 0.26
13 0.25
14 0.27
15 0.29
16 0.27
17 0.25
18 0.23
19 0.2
20 0.22
21 0.26
22 0.27
23 0.32
24 0.39
25 0.37
26 0.38
27 0.41
28 0.44
29 0.43
30 0.44
31 0.41
32 0.38
33 0.38
34 0.37
35 0.38
36 0.32
37 0.27
38 0.21
39 0.16
40 0.11
41 0.09
42 0.08
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.04
60 0.08
61 0.11
62 0.16
63 0.21
64 0.28
65 0.34
66 0.39
67 0.48
68 0.55
69 0.61
70 0.65
71 0.66
72 0.69
73 0.66
74 0.63
75 0.58
76 0.53
77 0.47
78 0.38
79 0.32
80 0.23
81 0.2
82 0.19
83 0.16
84 0.11
85 0.07
86 0.07
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.09
93 0.09
94 0.08
95 0.08
96 0.09
97 0.09
98 0.08
99 0.08
100 0.09
101 0.09
102 0.08
103 0.07
104 0.09
105 0.18
106 0.22
107 0.27
108 0.3
109 0.37
110 0.41
111 0.44
112 0.46
113 0.43
114 0.43
115 0.43
116 0.45
117 0.43
118 0.44
119 0.45
120 0.45
121 0.46
122 0.47
123 0.49
124 0.52
125 0.58
126 0.64
127 0.72
128 0.78
129 0.81
130 0.88
131 0.9
132 0.91
133 0.87
134 0.82
135 0.73
136 0.67
137 0.6
138 0.49
139 0.4
140 0.3
141 0.23
142 0.18
143 0.16
144 0.12
145 0.1
146 0.11
147 0.11
148 0.11
149 0.15