Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C6E8

Protein Details
Accession A0A1Y2C6E8   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
253-278TGGMAEMRRKEKKRRERERAAEVSKVBasic
NLS Segment(s)
PositionSequence
260-286RRKEKKRRERERAAEVSKVAKKNGGAP
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR008704  Endonuclease_Zinc-binding_loop  
IPR044925  His-Me_finger_sf  
IPR044930  Homing_endonuclease_His-Me  
Gene Ontology GO:0004519  F:endonuclease activity  
Pfam View protein in Pfam  
PF05551  zf-His_Me_endon  
Amino Acid Sequences MARAHSTPSPSPSPRKSRSSFTPRSSRTCTTKHLKSPYKEEEEDEDDLLSQIRRLNLPNTNIINVLSERYCTKVLLSIQCNEEDEHWLPNDRRARPKTNIGSHIIKAQDLTRRAGFLEGLKARKIQDLLQAALGDPSSRSDLDDSSVPIRLQCLAARSHYTKLKKPKPLTSLPPLQSSHLCHNPSCFSPSHLILETRAANIARNECRNCRNVIVEGEGGYSQFPCTHGDEKKGVPSCVLPTTRVVLQAEKSVTGGMAEMRRKEKKRRERERAAEVSKVAKKNGGAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.7
4 0.7
5 0.74
6 0.76
7 0.76
8 0.74
9 0.77
10 0.74
11 0.77
12 0.76
13 0.73
14 0.69
15 0.65
16 0.65
17 0.64
18 0.67
19 0.68
20 0.72
21 0.73
22 0.73
23 0.77
24 0.78
25 0.76
26 0.69
27 0.63
28 0.59
29 0.54
30 0.5
31 0.41
32 0.31
33 0.23
34 0.22
35 0.2
36 0.14
37 0.1
38 0.11
39 0.13
40 0.14
41 0.17
42 0.22
43 0.27
44 0.3
45 0.36
46 0.36
47 0.35
48 0.33
49 0.31
50 0.28
51 0.22
52 0.21
53 0.14
54 0.13
55 0.13
56 0.15
57 0.16
58 0.14
59 0.14
60 0.16
61 0.21
62 0.27
63 0.29
64 0.3
65 0.3
66 0.31
67 0.32
68 0.27
69 0.24
70 0.21
71 0.19
72 0.17
73 0.17
74 0.21
75 0.2
76 0.26
77 0.33
78 0.33
79 0.42
80 0.46
81 0.52
82 0.53
83 0.62
84 0.64
85 0.63
86 0.63
87 0.58
88 0.56
89 0.5
90 0.49
91 0.39
92 0.31
93 0.24
94 0.23
95 0.23
96 0.21
97 0.23
98 0.2
99 0.19
100 0.2
101 0.19
102 0.17
103 0.12
104 0.18
105 0.18
106 0.19
107 0.2
108 0.21
109 0.21
110 0.22
111 0.22
112 0.17
113 0.2
114 0.21
115 0.21
116 0.2
117 0.2
118 0.17
119 0.17
120 0.15
121 0.08
122 0.06
123 0.06
124 0.06
125 0.06
126 0.07
127 0.07
128 0.08
129 0.09
130 0.1
131 0.1
132 0.09
133 0.11
134 0.1
135 0.1
136 0.1
137 0.09
138 0.09
139 0.09
140 0.1
141 0.1
142 0.12
143 0.16
144 0.17
145 0.21
146 0.26
147 0.29
148 0.34
149 0.43
150 0.5
151 0.55
152 0.59
153 0.62
154 0.63
155 0.66
156 0.66
157 0.62
158 0.63
159 0.56
160 0.56
161 0.49
162 0.44
163 0.4
164 0.36
165 0.35
166 0.33
167 0.32
168 0.28
169 0.29
170 0.3
171 0.29
172 0.28
173 0.23
174 0.19
175 0.21
176 0.22
177 0.23
178 0.22
179 0.21
180 0.19
181 0.22
182 0.2
183 0.17
184 0.18
185 0.15
186 0.15
187 0.17
188 0.23
189 0.23
190 0.29
191 0.32
192 0.35
193 0.4
194 0.4
195 0.41
196 0.37
197 0.36
198 0.33
199 0.31
200 0.29
201 0.25
202 0.23
203 0.21
204 0.18
205 0.15
206 0.12
207 0.1
208 0.07
209 0.08
210 0.08
211 0.1
212 0.14
213 0.21
214 0.24
215 0.28
216 0.32
217 0.33
218 0.41
219 0.42
220 0.38
221 0.33
222 0.32
223 0.31
224 0.34
225 0.33
226 0.26
227 0.24
228 0.28
229 0.28
230 0.29
231 0.27
232 0.23
233 0.23
234 0.27
235 0.26
236 0.23
237 0.22
238 0.19
239 0.17
240 0.14
241 0.13
242 0.11
243 0.16
244 0.2
245 0.25
246 0.33
247 0.42
248 0.49
249 0.59
250 0.67
251 0.71
252 0.79
253 0.85
254 0.88
255 0.9
256 0.92
257 0.92
258 0.91
259 0.85
260 0.78
261 0.7
262 0.68
263 0.64
264 0.59
265 0.5
266 0.44