Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FVZ9

Protein Details
Accession A0A1Y2FVZ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-71IVSHKSRKQRKLQQAAYPPPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, extr 8, E.R. 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences MSSEASDICLYILACVFPPAAVGAVTGCSGQLVLNILLSLLWFPGVIHACIIVSHKSRKQRKLQQAAYPPPPTHMPGYQINQPNPGYGGQYAPQKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.07
5 0.07
6 0.07
7 0.07
8 0.06
9 0.06
10 0.05
11 0.06
12 0.06
13 0.06
14 0.05
15 0.05
16 0.05
17 0.04
18 0.05
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.03
28 0.03
29 0.03
30 0.03
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.09
39 0.09
40 0.11
41 0.16
42 0.2
43 0.3
44 0.38
45 0.46
46 0.55
47 0.63
48 0.71
49 0.77
50 0.8
51 0.79
52 0.8
53 0.8
54 0.76
55 0.7
56 0.6
57 0.52
58 0.47
59 0.41
60 0.35
61 0.29
62 0.27
63 0.29
64 0.32
65 0.38
66 0.43
67 0.42
68 0.44
69 0.42
70 0.39
71 0.34
72 0.31
73 0.26
74 0.19
75 0.21
76 0.19