Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EMD0

Protein Details
Accession A0A1Y2EMD0    Localization Confidence High Confidence Score 19.9
NoLS Segment(s)
PositionSequenceProtein Nature
233-254EEGKGKRKREHEEQRPGKKTKABasic
292-319PRPSGILTKKEKKDKKDAKRRANKEAAEBasic
NLS Segment(s)
PositionSequence
21-31ARGRGRGGSRG
236-275KGKRKREHEEQRPGKKTKAAATAPPKVLASASAPKPTPKP
290-322PAPRPSGILTKKEKKDKKDAKRRANKEAAEAKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MHPDRQAHVLNPREPSTRGSARGRGRGGSRGGRGTSNASQGLPSEIPSGSISKLKAQLRQTKRLLARDDLTPDVRTTSERRQKTLEQELVKAEQSALEQKMVTRYRGVRFFERQKLLRKIKQAKKALEALPEDESHKSNLLDARVDLYYVLRYPKTQKYIALFPSGTYIPFSPAPPAETPPSDALSKRHALRSSIRKKVESGELPAEPESGELGIEGEEDVPAGSADVEGEEEEGKGKRKREHEEQRPGKKTKAAATAPPKVLASASAPKPTPKPTPSAAAPAPSTDSAPAPRPSGILTKKEKKDKKDAKRRANKEAAEAKKAAAVGGEEEEAAGEVAVAVGEQAEGEDKEGWAGEDDFFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.45
4 0.44
5 0.46
6 0.47
7 0.52
8 0.56
9 0.62
10 0.61
11 0.57
12 0.54
13 0.54
14 0.55
15 0.54
16 0.51
17 0.48
18 0.47
19 0.44
20 0.43
21 0.43
22 0.4
23 0.37
24 0.34
25 0.29
26 0.27
27 0.26
28 0.28
29 0.22
30 0.19
31 0.17
32 0.15
33 0.16
34 0.17
35 0.18
36 0.15
37 0.18
38 0.18
39 0.21
40 0.29
41 0.31
42 0.36
43 0.43
44 0.52
45 0.56
46 0.65
47 0.64
48 0.65
49 0.68
50 0.69
51 0.64
52 0.6
53 0.54
54 0.49
55 0.49
56 0.44
57 0.4
58 0.34
59 0.29
60 0.25
61 0.24
62 0.22
63 0.24
64 0.3
65 0.37
66 0.39
67 0.42
68 0.46
69 0.51
70 0.56
71 0.61
72 0.57
73 0.51
74 0.5
75 0.5
76 0.46
77 0.41
78 0.33
79 0.23
80 0.17
81 0.16
82 0.18
83 0.16
84 0.15
85 0.15
86 0.15
87 0.24
88 0.24
89 0.24
90 0.24
91 0.29
92 0.33
93 0.4
94 0.43
95 0.41
96 0.47
97 0.54
98 0.58
99 0.6
100 0.59
101 0.62
102 0.68
103 0.7
104 0.67
105 0.69
106 0.71
107 0.73
108 0.77
109 0.77
110 0.7
111 0.66
112 0.68
113 0.6
114 0.55
115 0.48
116 0.41
117 0.34
118 0.31
119 0.28
120 0.22
121 0.21
122 0.16
123 0.16
124 0.14
125 0.14
126 0.16
127 0.15
128 0.14
129 0.13
130 0.15
131 0.13
132 0.13
133 0.11
134 0.09
135 0.08
136 0.09
137 0.11
138 0.09
139 0.11
140 0.16
141 0.22
142 0.26
143 0.27
144 0.29
145 0.31
146 0.36
147 0.36
148 0.35
149 0.29
150 0.24
151 0.25
152 0.22
153 0.19
154 0.14
155 0.12
156 0.1
157 0.11
158 0.12
159 0.1
160 0.11
161 0.13
162 0.13
163 0.15
164 0.15
165 0.14
166 0.16
167 0.16
168 0.17
169 0.15
170 0.15
171 0.15
172 0.18
173 0.21
174 0.21
175 0.24
176 0.23
177 0.25
178 0.32
179 0.41
180 0.45
181 0.5
182 0.51
183 0.47
184 0.47
185 0.48
186 0.47
187 0.39
188 0.34
189 0.29
190 0.27
191 0.27
192 0.26
193 0.23
194 0.15
195 0.13
196 0.09
197 0.05
198 0.05
199 0.04
200 0.04
201 0.03
202 0.04
203 0.04
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.04
218 0.04
219 0.04
220 0.06
221 0.08
222 0.13
223 0.17
224 0.22
225 0.28
226 0.35
227 0.43
228 0.52
229 0.62
230 0.67
231 0.75
232 0.8
233 0.84
234 0.85
235 0.81
236 0.73
237 0.66
238 0.6
239 0.55
240 0.54
241 0.47
242 0.47
243 0.52
244 0.56
245 0.53
246 0.5
247 0.43
248 0.34
249 0.31
250 0.24
251 0.21
252 0.21
253 0.22
254 0.25
255 0.26
256 0.28
257 0.32
258 0.36
259 0.4
260 0.34
261 0.37
262 0.35
263 0.41
264 0.4
265 0.44
266 0.4
267 0.35
268 0.33
269 0.29
270 0.29
271 0.24
272 0.22
273 0.16
274 0.17
275 0.17
276 0.21
277 0.22
278 0.21
279 0.21
280 0.21
281 0.22
282 0.29
283 0.32
284 0.35
285 0.43
286 0.51
287 0.59
288 0.69
289 0.74
290 0.72
291 0.78
292 0.81
293 0.83
294 0.84
295 0.86
296 0.87
297 0.91
298 0.9
299 0.9
300 0.88
301 0.79
302 0.77
303 0.77
304 0.71
305 0.66
306 0.6
307 0.49
308 0.42
309 0.4
310 0.3
311 0.21
312 0.16
313 0.12
314 0.13
315 0.13
316 0.1
317 0.1
318 0.1
319 0.09
320 0.08
321 0.06
322 0.04
323 0.03
324 0.03
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.03
331 0.03
332 0.06
333 0.06
334 0.09
335 0.1
336 0.1
337 0.11
338 0.11
339 0.12
340 0.12
341 0.13