Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2G3F4

Protein Details
Accession A0A1Y2G3F4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
152-182EKSGERERERERRRSRSPRREDERERERERRBasic
NLS Segment(s)
PositionSequence
124-227EKEAHRKEKEERRKERAFKREERERKRGEKSGERERERERRRSRSPRREDERERERERRSRDGERERERAYEDRDKRRGSDYDRERRGGSVKRRDEGERDRYRS
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019315  MMTA2_N  
IPR039207  MMTAG2-like  
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF10159  MMtag  
Amino Acid Sequences MYNPIRGGTRGGQGDFKWSDVASDKDRENYLGHSVNAPVGRWQNGKDLTWYNKDGKEPTEGEKEDKRREEIRAIKEAEEDALAVALGFAPIVRPPRPPPGSSTQDPTNEAETHSNESILARAAEKEAHRKEKEERRKERAFKREERERKRGEKSGERERERERRRSRSPRREDERERERERRSRDGERERERAYEDRDKRRGSDYDRERRGGSVKRRDEGERDRYRSRDDDRDSGSRRGDYGGKEKSRSPVGSRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.32
4 0.26
5 0.22
6 0.23
7 0.23
8 0.27
9 0.24
10 0.28
11 0.28
12 0.31
13 0.32
14 0.32
15 0.29
16 0.27
17 0.29
18 0.27
19 0.26
20 0.24
21 0.23
22 0.25
23 0.25
24 0.22
25 0.21
26 0.21
27 0.25
28 0.25
29 0.26
30 0.3
31 0.33
32 0.33
33 0.33
34 0.36
35 0.38
36 0.41
37 0.43
38 0.4
39 0.41
40 0.43
41 0.41
42 0.36
43 0.36
44 0.33
45 0.34
46 0.37
47 0.35
48 0.37
49 0.43
50 0.48
51 0.5
52 0.51
53 0.51
54 0.46
55 0.48
56 0.53
57 0.53
58 0.52
59 0.51
60 0.5
61 0.46
62 0.43
63 0.4
64 0.31
65 0.22
66 0.16
67 0.09
68 0.06
69 0.05
70 0.04
71 0.04
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.05
78 0.08
79 0.1
80 0.13
81 0.16
82 0.26
83 0.3
84 0.3
85 0.34
86 0.38
87 0.44
88 0.43
89 0.44
90 0.39
91 0.38
92 0.39
93 0.36
94 0.31
95 0.25
96 0.24
97 0.22
98 0.19
99 0.2
100 0.18
101 0.16
102 0.13
103 0.13
104 0.12
105 0.1
106 0.09
107 0.06
108 0.06
109 0.06
110 0.09
111 0.1
112 0.18
113 0.22
114 0.3
115 0.3
116 0.32
117 0.4
118 0.48
119 0.58
120 0.6
121 0.64
122 0.64
123 0.73
124 0.79
125 0.79
126 0.79
127 0.76
128 0.74
129 0.74
130 0.77
131 0.78
132 0.78
133 0.78
134 0.76
135 0.76
136 0.74
137 0.72
138 0.68
139 0.66
140 0.65
141 0.66
142 0.69
143 0.64
144 0.63
145 0.64
146 0.68
147 0.65
148 0.69
149 0.67
150 0.67
151 0.74
152 0.81
153 0.84
154 0.85
155 0.88
156 0.89
157 0.88
158 0.89
159 0.87
160 0.86
161 0.84
162 0.83
163 0.8
164 0.77
165 0.76
166 0.74
167 0.72
168 0.71
169 0.68
170 0.68
171 0.71
172 0.73
173 0.76
174 0.76
175 0.76
176 0.68
177 0.63
178 0.58
179 0.53
180 0.5
181 0.5
182 0.51
183 0.55
184 0.6
185 0.6
186 0.58
187 0.59
188 0.58
189 0.55
190 0.57
191 0.57
192 0.6
193 0.64
194 0.64
195 0.59
196 0.55
197 0.55
198 0.54
199 0.53
200 0.53
201 0.54
202 0.55
203 0.58
204 0.59
205 0.61
206 0.61
207 0.62
208 0.61
209 0.62
210 0.64
211 0.63
212 0.65
213 0.64
214 0.61
215 0.61
216 0.57
217 0.58
218 0.58
219 0.64
220 0.64
221 0.62
222 0.59
223 0.5
224 0.45
225 0.41
226 0.39
227 0.36
228 0.4
229 0.44
230 0.46
231 0.48
232 0.5
233 0.53
234 0.56
235 0.55
236 0.53