Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C373

Protein Details
Accession A0A1Y2C373   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-38WKSPWRMSKTRKMRARLRLKAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRQSATAFGGLLWKSPWRMSKTRKMRARLRLKAVDDVIATVEASGVQTHSLVRALALPTEQEMHPKDKYTTFSRTDPGYRKSMHKVPKWTRITSRTNPLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.16
5 0.16
6 0.2
7 0.27
8 0.28
9 0.37
10 0.44
11 0.54
12 0.62
13 0.71
14 0.75
15 0.76
16 0.79
17 0.8
18 0.83
19 0.81
20 0.78
21 0.75
22 0.7
23 0.66
24 0.58
25 0.49
26 0.38
27 0.3
28 0.22
29 0.14
30 0.12
31 0.07
32 0.06
33 0.04
34 0.04
35 0.04
36 0.03
37 0.03
38 0.04
39 0.04
40 0.04
41 0.05
42 0.04
43 0.04
44 0.06
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.09
51 0.09
52 0.11
53 0.13
54 0.17
55 0.18
56 0.2
57 0.22
58 0.23
59 0.28
60 0.29
61 0.33
62 0.33
63 0.35
64 0.36
65 0.37
66 0.41
67 0.43
68 0.42
69 0.42
70 0.4
71 0.43
72 0.48
73 0.53
74 0.55
75 0.56
76 0.63
77 0.66
78 0.73
79 0.74
80 0.73
81 0.74
82 0.73
83 0.75
84 0.72
85 0.73