Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FVJ8

Protein Details
Accession A0A1Y2FVJ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-108DTLEGILRRRRRDRDRRWMGKRKSWGWRBasic
NLS Segment(s)
PositionSequence
88-108RRRRRDRDRRWMGKRKSWGWR
Subcellular Location(s) plas 15, vacu 4, extr 3, mito 2, cyto 1, pero 1, E.R. 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR019013  Vma21  
Gene Ontology GO:0031410  C:cytoplasmic vesicle  
GO:0016020  C:membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF09446  VMA21  
Amino Acid Sequences HAPTPAHLKAAIPADGPTAPLTGVLIKLGLFTLAMVVLPVGSYFVSRDWYFGDNLTGAGITAATVANLILVAFVVVALREDTLEGILRRRRRDRDRRWMGKRKSWGWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.15
5 0.12
6 0.1
7 0.09
8 0.09
9 0.08
10 0.08
11 0.07
12 0.06
13 0.06
14 0.06
15 0.06
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.05
32 0.08
33 0.08
34 0.09
35 0.11
36 0.12
37 0.12
38 0.12
39 0.12
40 0.09
41 0.09
42 0.08
43 0.06
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.09
71 0.09
72 0.15
73 0.22
74 0.28
75 0.36
76 0.44
77 0.53
78 0.62
79 0.72
80 0.77
81 0.82
82 0.88
83 0.9
84 0.93
85 0.94
86 0.92
87 0.9
88 0.89