Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9P821

Protein Details
Accession G9P821    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
76-119IQAIKDKRTRKEEKERYEKLAEKMHHKRVERLKRKEKRNKLLNSBasic
NLS Segment(s)
PositionSequence
19-41LGMRKNGKQWHAPKKAFRPTRGL
47-115RTKERAAMAQMKAKEKELKQEKEEERQRRIQAIKDKRTRKEEKERYEKLAEKMHHKRVERLKRKEKRNK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTMEGSTDKVAEKSTKPLGMRKNGKQWHAPKKAFRPTRGLSSYEQRTKERAAMAQMKAKEKELKQEKEEERQRRIQAIKDKRTRKEEKERYEKLAEKMHHKRVERLKRKEKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.33
4 0.34
5 0.41
6 0.46
7 0.52
8 0.59
9 0.6
10 0.65
11 0.66
12 0.68
13 0.7
14 0.71
15 0.72
16 0.73
17 0.72
18 0.7
19 0.73
20 0.79
21 0.77
22 0.71
23 0.68
24 0.61
25 0.64
26 0.58
27 0.51
28 0.44
29 0.45
30 0.5
31 0.47
32 0.48
33 0.4
34 0.4
35 0.38
36 0.38
37 0.32
38 0.26
39 0.25
40 0.28
41 0.29
42 0.31
43 0.32
44 0.32
45 0.31
46 0.32
47 0.31
48 0.25
49 0.33
50 0.38
51 0.39
52 0.38
53 0.47
54 0.47
55 0.52
56 0.61
57 0.58
58 0.54
59 0.57
60 0.56
61 0.54
62 0.53
63 0.5
64 0.52
65 0.55
66 0.6
67 0.62
68 0.69
69 0.69
70 0.76
71 0.78
72 0.77
73 0.78
74 0.78
75 0.79
76 0.82
77 0.79
78 0.76
79 0.76
80 0.72
81 0.65
82 0.63
83 0.56
84 0.56
85 0.6
86 0.64
87 0.63
88 0.6
89 0.65
90 0.67
91 0.75
92 0.76
93 0.78
94 0.79
95 0.82
96 0.9
97 0.93
98 0.93
99 0.92