Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FRM1

Protein Details
Accession A0A1Y2FRM1   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
194-220LKQSTGPPLRHRRKDVPAHPRRRASTFHydrophilic
NLS Segment(s)
PositionSequence
204-214HRRKDVPAHPR
Subcellular Location(s) extr 14, nucl 7, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MHLPTITILLGLLPYSLAAPTRRVDPLLNSLFSSSQGGAAADLSYAQAQKAMQENPNLVAHLTDKGRERLEETSRKSVRLSDGTVFQGSGLKQPTSLRTPQQPINPLALPIKNTTPFFTSLRRANEALKHPSTSPSALHVQPQDYSPSIFSEVIQWIALPNSRRHQGFWEVPVDSIQVNGKRIEGPFAGAVFDLKQSTGPPLRHRRKDVPAHPRRRASTFHLGYFLCHLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.08
5 0.09
6 0.12
7 0.14
8 0.18
9 0.2
10 0.21
11 0.23
12 0.24
13 0.32
14 0.33
15 0.33
16 0.3
17 0.29
18 0.28
19 0.27
20 0.25
21 0.16
22 0.13
23 0.12
24 0.12
25 0.1
26 0.1
27 0.09
28 0.06
29 0.06
30 0.06
31 0.07
32 0.07
33 0.06
34 0.08
35 0.07
36 0.1
37 0.15
38 0.18
39 0.2
40 0.23
41 0.24
42 0.26
43 0.27
44 0.24
45 0.19
46 0.16
47 0.14
48 0.15
49 0.15
50 0.15
51 0.18
52 0.21
53 0.22
54 0.22
55 0.23
56 0.26
57 0.33
58 0.38
59 0.4
60 0.47
61 0.47
62 0.47
63 0.45
64 0.42
65 0.39
66 0.34
67 0.32
68 0.23
69 0.25
70 0.26
71 0.25
72 0.22
73 0.17
74 0.16
75 0.13
76 0.15
77 0.14
78 0.12
79 0.13
80 0.15
81 0.18
82 0.2
83 0.23
84 0.22
85 0.26
86 0.3
87 0.34
88 0.37
89 0.38
90 0.35
91 0.36
92 0.33
93 0.28
94 0.26
95 0.23
96 0.2
97 0.17
98 0.17
99 0.16
100 0.17
101 0.16
102 0.16
103 0.18
104 0.18
105 0.2
106 0.22
107 0.24
108 0.27
109 0.29
110 0.28
111 0.28
112 0.32
113 0.34
114 0.36
115 0.32
116 0.31
117 0.28
118 0.3
119 0.29
120 0.25
121 0.2
122 0.17
123 0.19
124 0.18
125 0.21
126 0.2
127 0.2
128 0.19
129 0.19
130 0.18
131 0.15
132 0.15
133 0.13
134 0.12
135 0.14
136 0.13
137 0.12
138 0.13
139 0.13
140 0.13
141 0.12
142 0.11
143 0.08
144 0.09
145 0.12
146 0.12
147 0.15
148 0.19
149 0.24
150 0.25
151 0.26
152 0.3
153 0.35
154 0.36
155 0.36
156 0.35
157 0.31
158 0.3
159 0.29
160 0.26
161 0.18
162 0.15
163 0.16
164 0.15
165 0.16
166 0.16
167 0.17
168 0.19
169 0.19
170 0.22
171 0.18
172 0.17
173 0.17
174 0.16
175 0.16
176 0.13
177 0.14
178 0.11
179 0.12
180 0.1
181 0.08
182 0.09
183 0.09
184 0.16
185 0.22
186 0.25
187 0.34
188 0.45
189 0.55
190 0.64
191 0.71
192 0.74
193 0.77
194 0.84
195 0.84
196 0.84
197 0.84
198 0.86
199 0.87
200 0.87
201 0.82
202 0.75
203 0.71
204 0.67
205 0.68
206 0.62
207 0.56
208 0.52
209 0.47
210 0.44