Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FEH2

Protein Details
Accession A0A1Y2FEH2    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-34QKAPGRLKSWRWRSKSCRCRCSPRSCSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 13.333, nucl 3, cyto_nucl 2.833
Family & Domain DBs
Amino Acid Sequences MGCATVQKAPGRLKSWRWRSKSCRCRCSPRSCSSRSSRCEEVGEACAAVRACRLKMRVCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.67
4 0.68
5 0.72
6 0.77
7 0.82
8 0.84
9 0.83
10 0.82
11 0.8
12 0.83
13 0.82
14 0.83
15 0.8
16 0.78
17 0.75
18 0.69
19 0.69
20 0.67
21 0.67
22 0.61
23 0.59
24 0.53
25 0.48
26 0.47
27 0.41
28 0.36
29 0.29
30 0.25
31 0.19
32 0.16
33 0.16
34 0.14
35 0.13
36 0.14
37 0.14
38 0.16
39 0.22
40 0.26