Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2DIK6

Protein Details
Accession A0A1Y2DIK6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-40VEPQEKKKKVCGRAKKRITDSBasic
NLS Segment(s)
PositionSequence
19-36KVEPQEKKKKVCGRAKKR
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences GKVHGSLARAGKVKSQTPKVEPQEKKKKVCGRAKKRITDSIRNLQVTTQIGGKKAGMNKQPEGKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.48
4 0.5
5 0.59
6 0.61
7 0.66
8 0.66
9 0.69
10 0.72
11 0.74
12 0.74
13 0.73
14 0.73
15 0.73
16 0.76
17 0.77
18 0.76
19 0.79
20 0.82
21 0.81
22 0.77
23 0.77
24 0.73
25 0.72
26 0.68
27 0.67
28 0.65
29 0.58
30 0.54
31 0.45
32 0.42
33 0.34
34 0.28
35 0.23
36 0.18
37 0.19
38 0.2
39 0.2
40 0.21
41 0.25
42 0.31
43 0.33
44 0.38
45 0.43
46 0.51