FuNGI

A0A1Y2G2R0

Protein Details

Accession

A0A1Y2G2R0

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
533-575	GAKDKFGKGKSKVRSKKAERAEGRDWDRPVKEGRRKKGGNARD	Basic

NLS Segment(s)

Position	Sequence
534-571	AKDKFGKGKSKVRSKKAERAEGRDWDRPVKEGRRKKGG

Subcellular Location(s)

mito 27

Family & Domain DBs

InterPro	View protein in InterPro IPR015324 Ribosomal_Rsm22-like
Gene Ontology	GO:0005739 C:mitochondrion GO:0008168 F:methyltransferase activity GO:0032259 P:methylation GO:0006412 P:translation
Pfam	View protein in Pfam PF09243 Rsm22

Amino Acid Sequences

MLTRSSLAPRSALRRGMKIDALSRLQLDINAAHNSLQESYREPAAPVEKSPEAVRGESLRGDVQLPRDLQEAVDKAILEADDGPALRTHALSLYAHLRETSSILPPPSSYRDRLALTTTYDESTSLAYLAGLMPSVYGATLHALTMARNRLGLVDGGAEEWVPEQVLDFGSGTASAAWAFDEVWPATGKGEQREYVGMEAARSMVELGSSMLGALPQRIVEVEGGQFEGTPKLPATIHQLTLPAHQGTLAKMQISATNLANKRTLAVAAFSLGELSTKEKRKEFVRAMWESGAEVLVLVERGTPGGSRMIVEAREQLLMLGRRSKNWEAELAEVEGPGAPKKGAYVLAPCPHDGACPLHNSTKTYCHFSQRVRSPPFLRHTKHTTRGEDDAKFSYVVIRRGTRPSSGLLQAQPHADLTIAEETLETLLQQAVEEESSELAIETLEPEPATPEGIELAWPRLVAPPLKRSGHVILEVCTASGALERHTIPKSQGRQAYYDARKVAWGDSFPHAPKNGPQPAPAAIASAAQEAAGAKDKFGKGKSKVRSKKAERAEGRDWDRPVKEGRRKKGGNARDGEVQDFELTIGPDGQFKIL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.52
3	0.53
4	0.53
5	0.5
6	0.48
7	0.47
8	0.46
9	0.41
10	0.37
11	0.33
12	0.29
13	0.26
14	0.23
15	0.19
16	0.19
17	0.2
18	0.19
19	0.18
20	0.19
21	0.2
22	0.2
23	0.19
24	0.16
25	0.18
26	0.2
27	0.23
28	0.23
29	0.22
30	0.26
31	0.3
32	0.3
33	0.28
34	0.32
35	0.29
36	0.3
37	0.31
38	0.31
39	0.28
40	0.27
41	0.28
42	0.25
43	0.26
44	0.26
45	0.27
46	0.22
47	0.2
48	0.21
49	0.21
50	0.21
51	0.25
52	0.24
53	0.24
54	0.24
55	0.23
56	0.22
57	0.26
58	0.23
59	0.2
60	0.21
61	0.19
62	0.17
63	0.19
64	0.18
65	0.12
66	0.11
67	0.1
68	0.1
69	0.1
70	0.11
71	0.1
72	0.11
73	0.11
74	0.1
75	0.1
76	0.09
77	0.12
78	0.11
79	0.14
80	0.19
81	0.19
82	0.2
83	0.19
84	0.18
85	0.17
86	0.19
87	0.18
88	0.16
89	0.18
90	0.19
91	0.2
92	0.2
93	0.24
94	0.28
95	0.3
96	0.29
97	0.3
98	0.34
99	0.35
100	0.35
101	0.35
102	0.3
103	0.29
104	0.29
105	0.27
106	0.23
107	0.21
108	0.2
109	0.16
110	0.15
111	0.12
112	0.09
113	0.07
114	0.06
115	0.06
116	0.06
117	0.06
118	0.05
119	0.04
120	0.04
121	0.04
122	0.04
123	0.04
124	0.03
125	0.04
126	0.05
127	0.06
128	0.06
129	0.07
130	0.08
131	0.09
132	0.13
133	0.16
134	0.15
135	0.15
136	0.15
137	0.14
138	0.15
139	0.14
140	0.1
141	0.08
142	0.08
143	0.08
144	0.08
145	0.07
146	0.06
147	0.06
148	0.05
149	0.04
150	0.04
151	0.04
152	0.05
153	0.05
154	0.06
155	0.06
156	0.06
157	0.06
158	0.06
159	0.06
160	0.05
161	0.05
162	0.04
163	0.04
164	0.04
165	0.04
166	0.05
167	0.05
168	0.08
169	0.08
170	0.09
171	0.09
172	0.1
173	0.1
174	0.12
175	0.14
176	0.14
177	0.18
178	0.17
179	0.18
180	0.19
181	0.2
182	0.18
183	0.18
184	0.14
185	0.11
186	0.11
187	0.09
188	0.08
189	0.07
190	0.06
191	0.04
192	0.04
193	0.04
194	0.04
195	0.04
196	0.04
197	0.04
198	0.04
199	0.04
200	0.05
201	0.05
202	0.05
203	0.04
204	0.05
205	0.05
206	0.06
207	0.06
208	0.07
209	0.07
210	0.07
211	0.07
212	0.07
213	0.07
214	0.07
215	0.08
216	0.07
217	0.07
218	0.07
219	0.08
220	0.08
221	0.1
222	0.17
223	0.19
224	0.19
225	0.19
226	0.21
227	0.2
228	0.22
229	0.23
230	0.15
231	0.12
232	0.13
233	0.13
234	0.12
235	0.15
236	0.13
237	0.11
238	0.11
239	0.11
240	0.12
241	0.13
242	0.14
243	0.11
244	0.18
245	0.19
246	0.2
247	0.21
248	0.19
249	0.18
250	0.16
251	0.16
252	0.09
253	0.09
254	0.07
255	0.07
256	0.07
257	0.06
258	0.06
259	0.05
260	0.05
261	0.05
262	0.08
263	0.14
264	0.18
265	0.21
266	0.23
267	0.26
268	0.29
269	0.37
270	0.37
271	0.38
272	0.41
273	0.4
274	0.4
275	0.38
276	0.35
277	0.26
278	0.23
279	0.16
280	0.08
281	0.06
282	0.04
283	0.03
284	0.03
285	0.03
286	0.03
287	0.03
288	0.03
289	0.03
290	0.03
291	0.04
292	0.05
293	0.05
294	0.06
295	0.07
296	0.08
297	0.08
298	0.09
299	0.1
300	0.1
301	0.1
302	0.09
303	0.09
304	0.11
305	0.12
306	0.12
307	0.18
308	0.18
309	0.2
310	0.25
311	0.28
312	0.27
313	0.27
314	0.29
315	0.23
316	0.24
317	0.24
318	0.2
319	0.18
320	0.14
321	0.13
322	0.1
323	0.09
324	0.08
325	0.07
326	0.05
327	0.05
328	0.06
329	0.07
330	0.08
331	0.08
332	0.12
333	0.16
334	0.21
335	0.23
336	0.22
337	0.22
338	0.21
339	0.2
340	0.17
341	0.16
342	0.13
343	0.15
344	0.17
345	0.2
346	0.21
347	0.23
348	0.23
349	0.29
350	0.29
351	0.33
352	0.33
353	0.36
354	0.4
355	0.42
356	0.49
357	0.49
358	0.56
359	0.53
360	0.57
361	0.53
362	0.56
363	0.59
364	0.58
365	0.54
366	0.51
367	0.55
368	0.58
369	0.64
370	0.64
371	0.6
372	0.56
373	0.59
374	0.58
375	0.5
376	0.46
377	0.38
378	0.32
379	0.28
380	0.24
381	0.23
382	0.21
383	0.23
384	0.24
385	0.25
386	0.27
387	0.32
388	0.34
389	0.3
390	0.28
391	0.27
392	0.28
393	0.27
394	0.28
395	0.25
396	0.25
397	0.25
398	0.24
399	0.22
400	0.18
401	0.15
402	0.12
403	0.09
404	0.1
405	0.1
406	0.09
407	0.08
408	0.08
409	0.08
410	0.08
411	0.08
412	0.05
413	0.04
414	0.05
415	0.05
416	0.05
417	0.05
418	0.05
419	0.06
420	0.06
421	0.06
422	0.06
423	0.06
424	0.06
425	0.05
426	0.04
427	0.04
428	0.04
429	0.05
430	0.06
431	0.06
432	0.06
433	0.06
434	0.08
435	0.08
436	0.09
437	0.07
438	0.07
439	0.07
440	0.08
441	0.1
442	0.09
443	0.11
444	0.11
445	0.11
446	0.11
447	0.14
448	0.16
449	0.19
450	0.23
451	0.28
452	0.34
453	0.36
454	0.36
455	0.38
456	0.4
457	0.39
458	0.39
459	0.33
460	0.27
461	0.29
462	0.28
463	0.23
464	0.18
465	0.14
466	0.1
467	0.11
468	0.1
469	0.08
470	0.12
471	0.13
472	0.18
473	0.19
474	0.21
475	0.23
476	0.31
477	0.36
478	0.41
479	0.45
480	0.43
481	0.45
482	0.49
483	0.55
484	0.52
485	0.51
486	0.45
487	0.4
488	0.39
489	0.37
490	0.34
491	0.27
492	0.24
493	0.22
494	0.25
495	0.3
496	0.29
497	0.33
498	0.32
499	0.3
500	0.34
501	0.4
502	0.44
503	0.4
504	0.41
505	0.39
506	0.4
507	0.42
508	0.36
509	0.28
510	0.19
511	0.19
512	0.18
513	0.16
514	0.13
515	0.09
516	0.1
517	0.08
518	0.1
519	0.16
520	0.15
521	0.15
522	0.22
523	0.24
524	0.29
525	0.33
526	0.41
527	0.41
528	0.5
529	0.6
530	0.64
531	0.72
532	0.77
533	0.84
534	0.83
535	0.85
536	0.86
537	0.87
538	0.83
539	0.82
540	0.8
541	0.78
542	0.76
543	0.73
544	0.67
545	0.64
546	0.58
547	0.53
548	0.55
549	0.56
550	0.6
551	0.63
552	0.68
553	0.71
554	0.73
555	0.79
556	0.8
557	0.79
558	0.78
559	0.73
560	0.68
561	0.65
562	0.64
563	0.57
564	0.48
565	0.4
566	0.31
567	0.25
568	0.22
569	0.15
570	0.14
571	0.13
572	0.13
573	0.12
574	0.14

A0A1Y2G2R0

3D AlphaFold-predicted Structure Viewer