Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3BBK6

Protein Details
Accession G3BBK6   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
98-125EINPCHKVCSDRKKRRLHMIDKHGYPRDBasic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 13, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039258  ZNF511  
IPR013087  Znf_C2H2_type  
KEGG cten:CANTEDRAFT_108530  -  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MSKRRRSEELLPSTTSATVPTIVCTLGYCVQAPPEFSSYPEYELHVQTHHTHICHACKKRFPSAPILSMHIEEKHDPFFVIKRDQGLKVYKCFKSYNEINPCHKVCSDRKKRRLHMIDKHGYPRDYNFSIIDRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.35
3 0.25
4 0.17
5 0.15
6 0.13
7 0.13
8 0.12
9 0.12
10 0.11
11 0.11
12 0.13
13 0.13
14 0.14
15 0.14
16 0.13
17 0.16
18 0.17
19 0.18
20 0.18
21 0.18
22 0.18
23 0.18
24 0.23
25 0.21
26 0.22
27 0.21
28 0.21
29 0.2
30 0.21
31 0.2
32 0.16
33 0.17
34 0.16
35 0.2
36 0.2
37 0.17
38 0.18
39 0.21
40 0.28
41 0.34
42 0.39
43 0.39
44 0.44
45 0.47
46 0.53
47 0.55
48 0.5
49 0.51
50 0.48
51 0.48
52 0.42
53 0.42
54 0.34
55 0.29
56 0.28
57 0.19
58 0.17
59 0.13
60 0.14
61 0.12
62 0.11
63 0.11
64 0.11
65 0.13
66 0.15
67 0.17
68 0.17
69 0.2
70 0.22
71 0.23
72 0.27
73 0.32
74 0.32
75 0.35
76 0.41
77 0.39
78 0.4
79 0.4
80 0.37
81 0.38
82 0.41
83 0.44
84 0.47
85 0.51
86 0.53
87 0.58
88 0.58
89 0.52
90 0.48
91 0.44
92 0.44
93 0.5
94 0.56
95 0.6
96 0.68
97 0.76
98 0.82
99 0.87
100 0.88
101 0.87
102 0.86
103 0.86
104 0.85
105 0.81
106 0.82
107 0.77
108 0.68
109 0.59
110 0.54
111 0.51
112 0.44
113 0.4
114 0.34
115 0.31