Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FU50

Protein Details
Accession A0A1Y2FU50    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MNISKLKVKPKRQQHIQACALEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MNISKLKVKPKRQQHIQACALELTAMLGCWASAGDLVGANACKESAKKLHECMSKPQVGGKARVSSINYHLSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.83
4 0.75
5 0.66
6 0.55
7 0.45
8 0.33
9 0.24
10 0.15
11 0.08
12 0.06
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.08
32 0.13
33 0.18
34 0.21
35 0.25
36 0.33
37 0.38
38 0.41
39 0.46
40 0.49
41 0.48
42 0.45
43 0.46
44 0.45
45 0.42
46 0.44
47 0.41
48 0.38
49 0.35
50 0.39
51 0.37
52 0.34
53 0.36
54 0.41